Enhanced Validation

Anti-DDX3X Antibody

DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked
References (6)
Recommended Applications
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human DDX3X
Alternative Gene Names
DBX, DDX14, DDX3, HLP2
Open Datasheet
Price
$459.00
Product Number
HPA001648
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Show all images
[10 pictures]
Immunohistochemical staining of human Fallopian tube shows weak cytoplasmic positivity in glandular cells.
Show all images
[2 pictures]
Western blot analysis using Anti-DDX3X antibody HPA001648 (A) shows similar pattern to independent antibody HPA005631 (B).
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked
Target Gene
DDX3X
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000000787 (97%)

Rat ENSRNOG00000023383 (97%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA001648 on the Human Protein Atlas
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA001648 on the Human Protein Atlas
Protein Name
DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked
Gene Name
DDX3X
Alternative Gene Names
DBX, DDX14, DDX3, HLP2
UniProt ID
O00571
Gene (Ensembl)
ENSG00000215301
Entrez Gene ID
Entrez gene: 1654
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000215301 on the Human Protein Atlas

Hayes LR, Duan L, Bowen K, Kalab P, Rothstein JD

C9orf72 arginine-rich dipeptide repeat proteins disrupt karyopherin-mediated nuclear import

eLife , 2020 Mar 2; 9:e51685. Epub 2020 Mar 2

PubMed ID: 32119645 DOI: 10.7554/eLife.51685

Kamelgarn M, Chen J, Kuang L, Arenas A, Zhai J, Zhu H, Gal J

Proteomic analysis of FUS interacting proteins provides insights into FUS function and its role in ALS

Biochim Biophys Acta , 2016 Jul 25; 1862(10):2004-2014. Epub 2016 Jul 25

PubMed ID: 27460707 DOI: 10.1016/j.bbadis.2016.07.015

Hagerstrand D, Tong A, Schumacher SE, Ilic N, Shen RR, Cheung HW, Vazquez F, Shrestha Y, Kim SY, Giacomelli AO, Rosenbluh J, Schinzel AC, Spardy NA, Barbie DA, Mermel CH, Weir BA, Garraway LA, Tamayo P, Mesirov JP, Beroukhim R, Hahn WC

Systematic interrogation of 3q26 identifies TLOC1 and SKIL as cancer drivers

Cancer Discov , 2013 Sep; 3(9):1044-1057. Epub 2013 Jun 13

PubMed ID: 23764425 DOI: 10.1158/2159-8290.CD-12-0592

Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E

Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.

J Proteomics , 2012 Apr 3; 75(7):2236-51. Epub 2012 Feb 15

PubMed ID: 22361696 DOI: 10.1016/j.jprot.2012.01.030

Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M

Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics

Mol Cell Proteomics , 2009 Jul; 8(7):1612-1622. Epub 2009 Apr 7

PubMed ID: 19351664 DOI: 10.1074/mcp.M800539-MCP200

Did we miss your publication?

Have you published using HPA001648? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-DDX3X (HPA005631)
Anti-DDX3X (HPA059585)
Corresponding Antigens
PrEST Antigen DDX3X (APrEST74302)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch