Polyclonal Anti-CTGF Antibody

connective tissue growth factor
Recommended Applications
Product Description
Polyclonal Antibody against Human CTGF
Alternative Gene Names
CCN2, IGFBP8
Price
$505.00
Product Number
HPA031075
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
connective tissue growth factor
Target Gene
CTGF
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000015036 (97%)

Mouse ENSMUSG00000019997 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
connective tissue growth factor
Gene Name
CTGF
Alternative Gene Names
CCN2, IGFBP8
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000118523 on the Human Protein Atlas

Tonner H, Hunn S, Auler N, Schmelter C, Beutgen VM, von Pein HD, Pfeiffer N, Grus FH

A Monoclonal Anti-HMGB1 Antibody Attenuates Neurodegeneration in an Experimental Animal Model of Glaucoma

Int J Mol Sci , 2022 Apr 7; 23(8):4107. Epub 2022 Apr 7

PubMed ID: 35456925 DOI: 10.3390/ijms23084107

Holmes B, Benavides-Serrato A, Saunders JT, Kumar S, Nishimura RN, Gera J

mTORC2-mediated direct phosphorylation regulates YAP activity promoting glioblastoma growth and invasive characteristics

Neoplasia , 2021 Jul 31; 23(9):951-965. Epub 2021 Jul 31

PubMed ID: 34343821 DOI: 10.1016/j.neo.2021.07.005

González-Alonso P, Zazo S, Martín-Aparicio E, Luque M, Chamizo C, Sanz-Álvarez M, Minguez P, Gómez-López G, Cristóbal I, Caramés C, García-Foncillas J, Eroles P, Lluch A, Arpí O, Rovira A, Albanell J, Piersma SR, Jimenez CR, Madoz-Gúrpide J, Rojo F

The Hippo Pathway Transducers YAP1/TEAD Induce Acquired Resistance to Trastuzumab in HER2-Positive Breast Cancer

Cancers (Basel) , 2020 Apr 29; 12(5):1108. Epub 2020 Apr 29

PubMed ID: 32365528 DOI: 10.3390/cancers12051108

Did we miss your publication?

Have you published using HPA031075? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch