1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-CTCFL
Enhanced Validation

Anti-CTCFL Antibody

CCCTC-binding factor (zinc finger protein)-like
References (5)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CTCFL
Alternative Gene Names
BORIS, CT27, dJ579F20.2
Open Datasheet
Price
$450.00
Product Number
HPA001472
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[3 pictures]
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA001472 antibody. Corresponding CTCFL RNA-seq data are presented for the same tissues.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
CCCTC-binding factor (zinc finger protein)-like
Target Gene
CTCFL
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000028661 (36%)

Mouse ENSMUSG00000070495 (36%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA001472 on the Human Protein Atlas
Protein Name
CCCTC-binding factor (zinc finger protein)-like
Gene Name
CTCFL
Alternative Gene Names
BORIS, CT27, dJ579F20.2
UniProt ID
Q8NI51
Gene (Ensembl)
ENSG00000124092
Entrez Gene ID
Entrez gene: 140690
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000124092 on the Human Protein Atlas

Asano T, Hirohashi Y, Torigoe T, Mariya T, Horibe R, Kuroda T, Tabuchi Y, Saijo H, Yasuda K, Mizuuchi M, Takahashi A, Asanuma H, Hasegawa T, Saito T, Sato N

Brother of the regulator of the imprinted site (BORIS) variant subfamily 6 is involved in cervical cancer stemness and can be a target of immunotherapy

Oncotarget , 2016 Feb 3; 7(10):11223-11237. Epub 2016 Feb 3

PubMed ID: 26849232 DOI: 10.18632/oncotarget.7165

Freitas MR, Malheiros SM, Stávale JN, Biassi TP, Zamunér FT, de Souza Begnami MD, Soares FA, Vettore AL

Expression of Cancer/Testis Antigens is Correlated with Improved Survival in Glioblastoma

Oncotarget , 2013 Apr; 4(4):636-646. Epub 2013 Apr 15

PubMed ID: 23592437 DOI: 10.18632/oncotarget.950

Jones TA, Ogunkolade BW, Szary J, Aarum J, Mumin MA, Patel S, Pieri CA, Sheer D

Widespread Expression of BORIS/CTCFL in Normal and Cancer Cells

PLoS One , 2011; 6(7):e22399. Epub 2011 Jul 19

PubMed ID: 21811597 DOI: 10.1371/journal.pone.0022399

Hines WC, Bazarov AV, Mukhopadhyay R, Yaswen P

BORIS (CTCFL) Is Not Expressed in Most Human Breast Cell Lines and High Grade Breast Carcinomas

PLoS One , 2010 Mar 17; 5(3):e9738. Epub 2010 Mar 17

PubMed ID: 20305816 DOI: 10.1371/journal.pone.0009738

Did we miss your publication?

Have you published using HPA001472? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens
PrEST Antigen CTCFL (APrEST79792)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-CTCFL