Polyclonal Anti-CTBP1 Antibody

C-terminal binding protein 1
Recommended Applications
Product Description
Polyclonal Antibody against Human CTBP1
Alternative Gene Names
BARS
Price
$459.00
Product Number
HPA018987
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
C-terminal binding protein 1
Target Gene
CTBP1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000037373 (97%)

Rat ENSRNOG00000005428 (95%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
C-terminal binding protein 1
Gene Name
CTBP1
Alternative Gene Names
BARS
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000159692 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA018987? Please let us know and we will be happy to include your reference on this page.

Read more

Human Protein Atlas Formal Validation Data - Genetic and Tagged Protein Strategies

Contribution from The Human Protein Atlas (proteinatlas.org) — October 16, 2015

The Human Protein Atlas has successfully tested the Anti-CTBP1 antibody (HPA018987) in siRNA transfected U-2 OS cells and HeLa cell lines stably expressing GFP-tagged target protein.

A. To validate the subcellular localization of the Anti-CTBP1 antibody (HPA018987), determined by immunofluorescence, the staining procedure was repeated on siRNA transfected U-2 OS cells. The assay was performed in duplicates using siRNA:s from two different providers (siRNA 1 and siRNA 2) and the results were compared to negative control cells transfected with scrambled siRNA.

hpa018987_sirna_kd_if    hpa018987_sirna_kd_stapel

Negative control (scrambled)                                     siRNA transfected U-2 OS cells


The images show signal downregulation > 25% compared to the negative control (scrambled). Relative Fluorescence Intensity (RFI) denotes the percentage of remaining staining intensity after siRNA down regulation.

B. The Anti-CTBP1 antibody (HPA018987) was tested in Western blot using siRNA transfected U-2 OS cells, from two different providers (siRNA 1 and siRNA 2), and the result shows specific downregulation in both siRNA lanes compared to the control (scrambled).

 hpa18987_sirna_wb

Western blot image for the HPA018987 antibody using lysates from siRNA transfected U-2 OS cells. 

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: siRNA 1
Lane 3: siRNA 2
Lane 4: scrambled

C. The Anti-CTBP1 antibody (HPA018987) was analyzed in HeLa cell lines stably expressing GFP-tagged target protein and the result shows that the antibody staining overlaps with GFP tagged protein.

1.                                                                                       2.                                                                                      3.

hpa018987_siRNA_if_green     hpa018987_siRNA_if_magenta     hpa018987_sirna_if_green_magenta

Images show immunofluorescent staining with the HPA018987 antibody in HeLa cells expressing C-terminal tagged target protein.

1. HPA018987 antibody staining in nucleus (green), but excluded from the nucleoli 2. GFP expression in nucleus (purple), but excluded from the nucleoli 3. HPA018987 antibody staining overlaps with GFP tagged protein. 

 

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch