Enhanced Validation

Anti-CST3 Antibody

cystatin C
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human CST3
Price
$445.00
Product Number
HPA013143
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
cystatin C
Target Gene
CST3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000005195 (73%)

Mouse ENSMUSG00000027447 (72%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
cystatin C
Gene Name
CST3
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000101439 on the Human Protein Atlas

Sekulovski N, Whorton AE, Shi M, MacLean JA II, Hayashi K

Endometriotic inflammatory microenvironment induced by macrophages can be targeted by niclosamide

Biol Reprod , 2018 Oct 16; 100(2):398-408. Epub 2018 Oct 16

PubMed ID: 30329025 DOI: 10.1093/biolre/ioy222

Asbjorg Osk Snorradottir, Helgi J Isaksson, Saevar Ingthorsson, Elias Olafsson, Astridur Palsdottir, Birkir Thor Bragason

Pathological changes in basement membranes and dermal connective tissue of skin from patients with hereditary cystatin C amyloid angiopathy

Laboratory Investigation , January 09, 2017

PubMed ID: None DOI: 10.1038/labinvest.2016.133

Wu CC, Hsu CW, Chen CD, Yu CJ, Chang KP, Tai DI, Liu HP, Su WH, Chang YS, Yu JS

Candidate Serological Biomarkers for Cancer Identified from the Secretomes of 23 Cancer Cell Lines and the Human Protein Atlas

Mol Cell Proteomics , 2010 Jun; 9(6):1100-1117. Epub 2010 Feb 1

PubMed ID: 20124221 DOI: 10.1074/mcp.M900398-MCP200

Did we miss your publication?

Have you published using HPA013143? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch