Anti-CSDE1 Antibody

cold shock domain containing E1, RNA-binding
Recommended Applications
Product Description
Polyclonal Antibody against Human CSDE1
Alternative Gene Names
D1S155E, UNR
Price
$445.00
Product Number
HPA018846
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
cold shock domain containing E1, RNA-binding
Target Gene
CSDE1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQEVFYLTYTPEDVEGNVQLETGDKIN
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000068823 (97%)

Rat ENSRNOG00000061058 (77%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
cold shock domain containing E1, RNA-binding
Gene Name
CSDE1
Alternative Gene Names
D1S155E, UNR
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000009307 on the Human Protein Atlas

Azzi-Martin L, He W, Péré-Védrenne C, Korolik V, Alix C, Prochazkova-Carlotti M, Morel JL, Le Roux-Goglin E, Lehours P, Djavaheri-Mergny M, Grosset CF, Varon C, Dubus P, Ménard A

Cytolethal distending toxin induces the formation of transient messenger-rich ribonucleoprotein nuclear invaginations in surviving cells

PLoS Pathog , 2019 Sep 30; 15(9):e1007921. Epub 2019 Sep 30

PubMed ID: 31568537 DOI: 10.1371/journal.ppat.1007921

Guo H, Li Y, Shen L, Wang T, Jia X, Liu L, Xu T, Ou M, Hoekzema K, Wu H, Gillentine MA, Liu C, Ni H, Peng P, Zhao R, Zhang Y, Phornphutkul C, Stegmann AP, Prada CE, Hopkin RJ, Shieh JT, McWalter K, Monaghan KG, van Hasselt PM, van Gassen K, Bai T, Long M, Han L, Quan Y, Chen M, Zhang Y, Li K, Zhang Q, Tan J, Zhu T, Liu Y, Pang N, Peng J, Scott DA, Lalani SR, Azamian M, Mancini GM, Adams DJ, Kvarnung M, Lindstrand A, Nordgren A, Pevsner J, Osei-Owusu IA, Romano C, Calabrese G, Galesi O, Gecz J, Haan E, Ranells J, Racobaldo M, Nordenskjold M, Madan-Khetarpal S, Sebastian J, Ball S, Zou X, Zhao J, Hu Z, Xia F, Liu P, Rosenfeld JA, de Vries BB, Bernier RA, Xu ZQ, Li H, Xie W, Hufnagel RB, Eichler EE, Xia K

Disruptive variants of CSDE1 associate with autism and interfere with neuronal development and synaptic transmission

Sci Adv , 2019 Sep 25; 5(9):eaax2166. Epub 2019 Sep 25

PubMed ID: 31579823 DOI: 10.1126/sciadv.aax2166

Did we miss your publication?

Have you published using HPA018846? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch