Enhanced Validation

Anti-CRIM1 Antibody

cysteine rich transmembrane BMP regulator 1 (chordin-like)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CRIM1
Alternative Gene Names
S52
Price
$445.00
Product Number
HPA000556
Unit Size
Concentration
Lot dependent
Availability
3 in Stock
Ships
Ready to Ship
Target Protein
cysteine rich transmembrane BMP regulator 1 (chordin-like)
Target Gene
CRIM1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCEVQFSPRCPEDSVLIEGYAPPGECCPLP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000024074 (88%)

Rat ENSRNOG00000004208 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
cysteine rich transmembrane BMP regulator 1 (chordin-like)
Gene Name
CRIM1
Alternative Gene Names
S52
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000150938 on the Human Protein Atlas

Hudson BD, Hum NR, Thomas CB, Kohlgruber A, Sebastian A, Collette NM, Coleman MA, Christiansen BA, Loots GG

SOST Inhibits Prostate Cancer Invasion

PLoS One , 2015; 10(11):e0142058. Epub 2015 Nov 6

PubMed ID: 26545120 DOI: 10.1371/journal.pone.0142058

Chiu HS, York JP, Wilkinson L, Zhang P, Little MH, Pennisi DJ

Production of a Mouse Line with a Conditional Crim1 Mutant Allele

Genesis , 2012 Sep; 50(9):711-716. Epub 2012 May 19

PubMed ID: 22511315 DOI: 10.1002/dvg.22032

Nyström J, Hultenby K, Ek S, Sjölund J, Axelson H, Jirström K, Saleem MA, Nilsson K, Johansson ME

CRIM1 is localized to the podocyte filtration slit diaphragm of the adult human kidney.

Nephrol Dial Transplant , 2009 Jul; 24(7):2038-44. Epub 2009 Jan 21

PubMed ID: 19158190 DOI: 10.1093/ndt/gfn743

Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA

From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.

Mol Cell Proteomics , 2006 Jun; 5(6):1072-81. Epub 2006 Mar 8

PubMed ID: 16524965 DOI: 10.1074/mcp.M600077-MCP200

Did we miss your publication?

Have you published using HPA000556? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch