Enhanced Validation

Anti-CRB3 Antibody

crumbs family member 3
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CRB3
Alternative Gene Names
MGC17303
Price
$445.00
Product Number
HPA013835
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
crumbs family member 3
Target Gene
CRB3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VRKLREKRQTEGTYRPSSEEQFSHAAEARAPQDSKETVQGCLPI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000044279 (91%)

Rat ENSRNOG00000047322 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
crumbs family member 3
Gene Name
CRB3
Alternative Gene Names
MGC17303
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000130545 on the Human Protein Atlas

Li P, Zhou C, Yan Y, Li J, Liu J, Zhang Y, Liu P

Crumbs protein homolog 3 (CRB3) expression is associated with oestrogen and progesterone receptor positivity in breast cancer

Clin Exp Pharmacol Physiol , 2019 Jun 10; 46(9):837-844. Epub 2019 Jun 10

PubMed ID: 31087799 DOI: 10.1111/1440-1681.13104

Zhu M, Leung CY, Shahbazi MN, Zernicka-Goetz M

Actomyosin polarisation through PLC-PKC triggers symmetry breaking of the mouse embryo

Nat Commun , 2017 Oct 13; 8:921. Epub 2017 Oct 13

PubMed ID: 29030553 DOI: 10.1038/s41467-017-00977-8

Li P, Wang Y, Mao X, Jiang Y, Liu J, Li J, Wang J, Wang R, She J, Zhang J, Yang J, Liu Y, Liu P

CRB3 downregulation confers breast cancer stem cell traits through TAZ/β-catenin

Oncogenesis , 2017 Apr 24; 6(4):e322-. Epub 2017 Apr 24

PubMed ID: 28436991 DOI: 10.1038/oncsis.2017.24

McNeill H, Reginensi A

Lats1/2 Regulate Yap/Taz to Control Nephron Progenitor Epithelialization and Inhibit Myofibroblast Formation

J Am Soc Nephrol , 2016 Sep 19; 28(3):852-861. Epub 2016 Sep 19

PubMed ID: 27647853 DOI: 10.1681/ASN.2016060611

Reginensi A, Enderle L, Gregorieff A, Johnson RL, Wrana JL, McNeill H

A critical role for NF2 and the Hippo pathway in branching morphogenesis

Nat Commun , 2016 Aug 2; 7:12309. Epub 2016 Aug 2

PubMed ID: 27480037 DOI: 10.1038/ncomms12309

Ying Gao, Wing-yee Lui, Will M. Lee, C. Yan Cheng

Polarity protein Crumbs homolog-3 (CRB3) regulates ectoplasmic specialization dynamics through its action on F-actin organization in Sertoli cells

Scientific Reports , 6, (2016)

PubMed ID: None DOI: 10.1038/srep28589

Freedman BS, Brooks CR, Lam AQ, Fu H, Morizane R, Agrawal V, Saad AF, Li MK, Hughes MR, Werff RV, Peters DT, Lu J, Baccei A, Siedlecki AM, Valerius MT, Musunuru K, McNagny KM, Steinman TI, Zhou J, Lerou PH, Bonventre JV

Modelling kidney disease with CRISPR-mutant kidney organoids derived from human pluripotent epiblast spheroids

Nat Commun , 2015 Oct 23; 6:8715. Epub 2015 Oct 23

PubMed ID: 26493500 DOI: 10.1038/ncomms9715

Reginensi A, Hoshi M, Boualia SK, Bouchard M, Jain S, McNeill H

Yap and Taz are required for Ret-dependent urinary tract morphogenesis

Development , 2015 Aug 1; 142(15):2696-2703

PubMed ID: 26243870 DOI: 10.1242/dev.122044

Did we miss your publication?

Have you published using HPA013835? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch