Anti-CP Antibody

ceruloplasmin (ferroxidase)
Recommended Applications
Product Description
Polyclonal Antibody against Human CP
Price
$445.00
Product Number
HPA001834
Unit Size
Concentration
Lot dependent
Availability
6 in Stock
Ships
Ready to Ship
Target Protein
ceruloplasmin (ferroxidase)
Target Gene
CP
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000011913 (83%)

Mouse ENSMUSG00000003617 (83%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
Protein Name
ceruloplasmin (ferroxidase)
Gene Name
CP
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000047457 on the Human Protein Atlas

Kaleri NA, Sun K, Wang L, Li J, Zhang W, Chen X, Li X

Dietary Copper Reduces the Hepatotoxicity of (−)-Epigallocatechin-3-Gallate in Mice

Molecules , 2017 Dec 23; 23(1):38. Epub 2017 Dec 23

PubMed ID: 29295524 DOI: 10.3390/molecules23010038

Hametner S, Wimmer I, Haider L, Pfeifenbring S, Brück W, Lassmann H

Iron and neurodegeneration in the multiple sclerosis brain

Ann Neurol , 2013 Dec; 74(6):848-861. Epub 2013 Oct 7

PubMed ID: 23868451 DOI: 10.1002/ana.23974

Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM

Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model

Proteome Sci , 2011 Nov 17; 9:73. Epub 2011 Nov 17

PubMed ID: 22093360 DOI: 10.1186/1477-5956-9-73

Did we miss your publication?

Have you published using HPA001834? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch