Anti-COL1A1 Antibody

collagen, type I, alpha 1
Recommended Applications
Product Description
Polyclonal Antibody against Human COL1A1
Alternative Gene Names
OI4
Price
$450.00
Product Number
HPA011795
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
collagen, type I, alpha 1
Target Gene
COL1A1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000001506 (63%)

Rat ENSRNOG00000003897 (62%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
collagen, type I, alpha 1
Gene Name
COL1A1
Alternative Gene Names
OI4
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000108821 on the Human Protein Atlas

Huang YL, Liang CY, Ritz D, Coelho R, Septiadi D, Estermann M, Cumin C, Rimmer N, Schötzau A, Núñez López M, Fedier A, Konantz M, Vlajnic T, Calabrese D, Lengerke C, David L, Rothen-Rutishauser B, Jacob F, Heinzelmann-Schwarz V

Collagen-rich omentum is a premetastatic niche for integrin α2-mediated peritoneal metastasis

eLife , 2020 Oct 7; 9:e59442. Epub 2020 Oct 7

PubMed ID: 33026975 DOI: 10.7554/eLife.59442

Tanaka Y, Shimanaka Y, Caddeo A, Kubo T, Mao Y, Kubota T, Kubota N, Yamauchi T, Mancina RM, Baselli G, Luukkonen P, Pihlajamäki J, Yki-Järvinen H, Valenti L, Arai H, Romeo S, Kono N

LPIAT1/MBOAT7 depletion increases triglyceride synthesis fueled by high phosphatidylinositol turnover

Gut , 2020 Apr 6; 70(1):180-193. Epub 2020 Apr 6

PubMed ID: 32253259 DOI: 10.1136/gutjnl-2020-320646

Russo C, Ferro Y, Maurotti S, Salvati MA, Mazza E, Pujia R, Terracciano R, Maggisano G, Mare R, Giannini S, Romeo S, Pujia A, Montalcini T

Lycopene and bone: an in vitro investigation and a pilot prospective clinical study

J Transl Med , 2020 Jan 29; 18:43. Epub 2020 Jan 29

PubMed ID: 31996227 DOI: 10.1186/s12967-020-02238-7

Pingitore P, Sasidharan K, Ekstrand M, Prill S, Lindén D, Romeo S

Human Multilineage 3D Spheroids as a Model of Liver Steatosis and Fibrosis

Int J Mol Sci , 2019 Apr 2; 20(7):1629. Epub 2019 Apr 2

PubMed ID: 30986904 DOI: 10.3390/ijms20071629

Pujia A, Russo C, Maurotti S, Pujia R, Mollace V, Romeo S, Montalcini T

Bergamot Polyphenol Fraction Exerts Effects on Bone Biology by Activating ERK 1/2 and Wnt/β-Catenin Pathway and Regulating Bone Biomarkers in Bone Cell Cultures

Nutrients , 2018 Sep 14; 10(9):1305. Epub 2018 Sep 14

PubMed ID: 30223488 DOI: 10.3390/nu10091305

Pingitore P, Dongiovanni P, Motta BM, Meroni M, Lepore SM, Mancina RM, Pelusi S, Russo C, Caddeo A, Rossi G, Montalcini T, Pujia A, Wiklund O, Valenti L, Romeo S

PNPLA3 overexpression results in reduction of proteins predisposing to fibrosis

Hum Mol Genet , 2016 Oct 13; 25(23):5212-5222. Epub 2016 Oct 13

PubMed ID: 27742777 DOI: 10.1093/hmg/ddw341

Did we miss your publication?

Have you published using HPA011795? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch