Enhanced Validation

Anti-CNDP1 Antibody

carnosine dipeptidase 1 (metallopeptidase M20 family)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CNDP1
Alternative Gene Names
CN1, CPGL2, HsT2308, MGC10825
Price
$445.00
Product Number
HPA008933
Unit Size
100 µl
Concentration
Lot dependent
Availability
9 in Stock
Ships
Ready to Ship
Target Protein
carnosine dipeptidase 1 (metallopeptidase M20 family)
Target Gene
CNDP1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000027739 (80%)

Mouse ENSMUSG00000056162 (79%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
carnosine dipeptidase 1 (metallopeptidase M20 family)
Gene Name
CNDP1
Alternative Gene Names
CN1, CPGL2, HsT2308, MGC10825
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000150656 on the Human Protein Atlas

Arner P, Henjes F, Schwenk JM, Darmanis S, Dahlman I, Iresjö BM, Naredi P, Agustsson T, Lundholm K, Nilsson P, Rydén M

Circulating Carnosine Dipeptidase 1 Associates with Weight Loss and Poor Prognosis in Gastrointestinal Cancer

PLoS One , 2015; 10(4):e0123566. Epub 2015 Apr 21

PubMed ID: 25898255 DOI: 10.1371/journal.pone.0123566

Adelmann K, Frey D, Riedl E, Koeppel H, Pfister F, Peters V, Schmitt CP, Sternik P, Hofmann S, Zentgraf HW, Navis G, van den Born J, Bakker SJ, Krämer BK, Yard BA, Hauske SJ

Different conformational forms of serum carnosinase detected by a newly developed sandwich ELISA for the measurements of carnosinase concentrations.

Amino Acids , 2012 Jul; 43(1):143-51. Epub 2012 Feb 17

PubMed ID: 22349764 DOI: 10.1007/s00726-012-1244-8

Hjelm B, Forsström B, Igel U, Johannesson H, Stadler C, Lundberg E, Ponten F, Sjöberg A, Rockberg J, Schwenk JM, Nilsson P, Johansson C, Uhlén M

Generation of monospecific antibodies based on affinity capture of polyclonal antibodies.

Protein Sci , 2011 Nov; 20(11):1824-35. Epub 2011 Oct 12

PubMed ID: 21898641 DOI: 10.1002/pro.716

Schwenk JM, Igel U, Neiman M, Langen H, Becker C, Bjartell A, Ponten F, Wiklund F, Grönberg H, Nilsson P, Uhlen M

Toward Next Generation Plasma Profiling via Heat-induced Epitope Retrieval and Array-based Assays

Mol Cell Proteomics , 2010 Nov; 9(11):2497-2507. Epub 2010 Aug 3

PubMed ID: 20682762 DOI: 10.1074/mcp.M110.001560

Peters V, Kebbewar M, Jansen EW, Jakobs C, Riedl E, Koeppel H, Frey D, Adelmann K, Klingbeil K, Mack M, Hoffmann GF, Janssen B, Zschocke J, Yard BA

Relevance of allosteric conformations and homocarnosine concentration on carnosinase activity.

Amino Acids , 2010 May; 38(5):1607-15. Epub 2009 Nov 14

PubMed ID: 19915793 DOI: 10.1007/s00726-009-0367-z

Ulrika Qundos, Henrik Johannesson, Claudia Fredolini, Gillian O’Hurley, Rui Branca, Mathias Uhlén, Fredrik Wiklund, Anders Bjartell, Peter Nilsson, Jochen M. Schwenk

Analysis of plasma from prostate cancer patients links decreased carnosine dipeptidase 1 levels to lymph node metastasis

Translational Proteomics , March, 2014; 2:14-24

PubMed ID: 0 DOI: 10.1016/j.trprot.2013.12.001

Did we miss your publication?

Have you published using HPA008933? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch