Enhanced Validation

Anti-CLU Antibody

clusterin
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CLU
Alternative Gene Names
APOJ, CLI, CLU1, CLU2, KUB1, SGP-2, SP-40, TRPM-2
Price
$445.00
Product Number
HPA000572
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
clusterin
Target Gene
CLU
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000016460 (69%)

Mouse ENSMUSG00000022037 (66%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
clusterin
Gene Name
CLU
Alternative Gene Names
APOJ, CLI, CLU1, CLU2, KUB1, SGP-2, SP-40, TRPM-2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000120885 on the Human Protein Atlas

Guantes R, Rastrojo A, Neves R, Lima A, Aguado B, Iborra FJ

Global variability in gene expression and alternative splicing is modulated by mitochondrial content

Genome Res , 2015 May; 25(5):633-644

PubMed ID: 25800673 DOI: 10.1101/gr.178426.114

Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM

Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model

Proteome Sci , 2011 Nov 17; 9:73. Epub 2011 Nov 17

PubMed ID: 22093360 DOI: 10.1186/1477-5956-9-73

Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA

From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.

Mol Cell Proteomics , 2006 Jun; 5(6):1072-81. Epub 2006 Mar 8

PubMed ID: 16524965 DOI: 10.1074/mcp.M600077-MCP200

Did we miss your publication?

Have you published using HPA000572? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch