Enhanced Validation

Anti-CKB Antibody

creatine kinase, brain
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CKB
Alternative Gene Names
CKBB
Price
$450.00
Product Number
HPA001254
Unit Size
Concentration
Lot dependent
Availability
8 in Stock
Ships
Ready to Ship
Target Protein
creatine kinase, brain
Target Gene
CKB
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000001270 (99%)

Rat ENSRNOG00000010872 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
creatine kinase, brain
Gene Name
CKB
Alternative Gene Names
CKBB
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000166165 on the Human Protein Atlas

Montenegro RC, Howarth A, Ceroni A, Fedele V, Farran B, Mesquita FP, Frejno M, Berger BT, Heinzlmeir S, Sailem HZ, Tesch R, Ebner D, Knapp S, Burbano R, Kuster B, Müller S

Identification of molecular targets for the targeted treatment of gastric cancer using dasatinib

Oncotarget , 2020 Feb 4; 11(5):535-549. Epub 2020 Feb 4

PubMed ID: 32082487 DOI: 10.18632/oncotarget.27462

Mello AA, Leal MF, Rey JA, Pinto GR, Lamarão LM, Montenegro RC, Alves AP, Assumpção PP, Borges BD, Smith MC, Burbano RR

Deregulated Expression of SRC, LYN and CKB Kinases by DNA Methylation and Its Potential Role in Gastric Cancer Invasiveness and Metastasis

PLoS One , 2015; 10(10):e0140492. Epub 2015 Oct 13

PubMed ID: 26460485 DOI: 10.1371/journal.pone.0140492

Bachmann J, Burté F, Pramana S, Conte I, Brown BJ, Orimadegun AE, Ajetunmobi WA, Afolabi NK, Akinkunmi F, Omokhodion S, Akinbami FO, Shokunbi WA, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk JM, Wahlgren M, Fernandez-Reyes D, Nilsson P

Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria

PLoS Pathog , 2014 Apr; 10(4):e1004038. Epub 2014 Apr 17

PubMed ID: 24743550 DOI: 10.1371/journal.ppat.1004038

Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM

Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model

Proteome Sci , 2011 Nov 17; 9:73. Epub 2011 Nov 17

PubMed ID: 22093360 DOI: 10.1186/1477-5956-9-73

Did we miss your publication?

Have you published using HPA001254? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch