Enhanced Validation

Anti-CIAPIN1 Antibody

cytokine induced apoptosis inhibitor 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CIAPIN1
Alternative Gene Names
Anamorsin
Price
$445.00
Product Number
HPA042182
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
cytokine induced apoptosis inhibitor 1
Target Gene
CIAPIN1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSD
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000016234 (92%)

Mouse ENSMUSG00000031781 (89%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
cytokine induced apoptosis inhibitor 1
Gene Name
CIAPIN1
Alternative Gene Names
Anamorsin
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000005194 on the Human Protein Atlas

Ferecatu I, Canal F, Fabbri L, Mazure NM, Bouton C, Golinelli-Cohen MP

Dysfunction in the mitochondrial Fe-S assembly machinery leads to formation of the chemoresistant truncated VDAC1 isoform without HIF-1α activation

PLoS One , 2018 Mar 29; 13(3):e0194782. Epub 2018 Mar 29

PubMed ID: 29596470 DOI: 10.1371/journal.pone.0194782

Ferecatu I, Gonçalves S, Golinelli-Cohen MP, Clémancey M, Martelli A, Riquier S, Guittet E, Latour JM, Puccio H, Drapier JC, Lescop E, Bouton C

The Diabetes Drug Target MitoNEET Governs a Novel Trafficking Pathway to Rebuild an Fe-S Cluster into Cytosolic Aconitase/Iron Regulatory Protein 1

J Biol Chem , 2014 Oct 10; 289(41):28070-28086. Epub 2014 Jul 10

PubMed ID: 25012650 DOI: 10.1074/jbc.M114.548438

Did we miss your publication?

Have you published using HPA042182? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch