Anti-CHN2 Antibody

chimerin 2
Recommended Applications
Product Description
Polyclonal Antibody against Human CHN2
Alternative Gene Names
ARHGAP3, RhoGAP3
Price
$450.00
Product Number
HPA018989
Unit Size
Concentration
Lot dependent
Availability
5 in Stock
Ships
Ready to Ship
Target Protein
chimerin 2
Target Gene
CHN2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKY
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000009411 (100%)

Mouse ENSMUSG00000004633 (100%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
Protein Name
chimerin 2
Gene Name
CHN2
Alternative Gene Names
ARHGAP3, RhoGAP3
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000106069 on the Human Protein Atlas

Elaimy AL, Guru S, Chang C, Ou J, Amante JJ, Zhu LJ, Goel HL, Mercurio AM

VEGF–Neuropilin-2 signaling promotes stem-like traits in breast cancer cells by TAZ-mediated repression of the Rac GAP β2-chimaerin

Sci Signal , 2018 May 1; 11(528):eaao6897. Epub 2018 May 1

PubMed ID: 29717062 DOI: 10.1126/scisignal.aao6897

Casado-Medrano V, Barrio-Real L, García-Rostán G, Baumann M, Rocks O, Caloca MJ

A new role of the Rac-GAP β2-chimaerin in cell adhesion reveals opposite functions in breast cancer initiation and tumor progression

Oncotarget , 2016 Apr 5; 7(19):28301-28319. Epub 2016 Apr 5

PubMed ID: 27058424 DOI: 10.18632/oncotarget.8597

Alvi MA, McArt DG, Kelly P, Fuchs MA, Alderdice M, McCabe CM, Bingham V, McGready C, Tripathi S, Emmert-Streib F, Loughrey MB, McQuaid S, Maxwell P, Hamilton PW, Turkington R, James JA, Wilson RH, Salto-Tellez M

Comprehensive molecular pathology analysis of small bowel adenocarcinoma reveals novel targets with potential for clinical utility

Oncotarget , 2015 Aug 28; 6(25):20863-20874. Epub 2015 Jul 30

PubMed ID: 26315110 DOI: 10.18632/oncotarget.4576

Did we miss your publication?

Have you published using HPA018989? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch