Anti-CEP128 Antibody

centrosomal protein 128kDa
Recommended Applications
Product Description
Polyclonal Antibody against Human CEP128
Alternative Gene Names
C14orf145, C14orf61
Price
$445.00
Product Number
HPA001116
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
centrosomal protein 128kDa
Target Gene
CEP128
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EEMGSLQDRVIALETSTQVALDHLESVPEKLSLLEDFKDFRDSCSSSERTDGRYSKYRVRRNSLQHHQDDTKYRTKSFKGDRTFLEGSHTRGLDHSSSWQDHSRFLSSPRFSYVNSFTKRTVAPDSASNKEDATMNGTSSQPK
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000061533 (65%)

Rat ENSRNOG00000012733 (25%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
Protein Name
centrosomal protein 128kDa
Gene Name
CEP128
Alternative Gene Names
C14orf145, C14orf61
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000100629 on the Human Protein Atlas

Mazo G, Soplop N, Wang WJ, Uryu K, Tsou MF

Spatial control of primary ciliogenesis by subdistal appendages alters sensation-associated properties of cilia

Dev Cell , 2016 Nov 3; 39(4):424-437. Epub 2016 Nov 3

PubMed ID: 27818179 DOI: 10.1016/j.devcel.2016.10.006

Jakobsen L, Vanselow K, Skogs M, Toyoda Y, Lundberg E, Poser I, Falkenby LG, Bennetzen M, Westendorf J, Nigg EA, Uhlen M, Hyman AA, Andersen JS

Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.

EMBO J , 2011 Apr 20; 30(8):1520-35. Epub 2011 Mar 11

PubMed ID: 21399614 DOI: 10.1038/emboj.2011.63

Did we miss your publication?

Have you published using HPA001116? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch