Anti-CDKL5 Antibody

cyclin-dependent kinase-like 5
Recommended Applications
Product Description
Polyclonal Antibody against Human CDKL5
Alternative Gene Names
EIEE2, STK9
Price
$450.00
Product Number
HPA002847
Unit Size
100 µl
Concentration
Lot dependent
Availability
4 in Stock
Ships
Ready to Ship
Target Protein
cyclin-dependent kinase-like 5
Target Gene
CDKL5
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AARANSLQLLSPQPGEQLPPEMTVARSSVKETSREGTSSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPSPRPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000003742 (97%)

Mouse ENSMUSG00000031292 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
cyclin-dependent kinase-like 5
Gene Name
CDKL5
Alternative Gene Names
EIEE2, STK9
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000008086 on the Human Protein Atlas

La Montanara P, Hervera A, Baltussen L, Hutson TH, Palmisano I, De Virgiliis F, Kong G, Chadwick J, Gao Y, Bartus K, Majid QA, Gorgoraptis N, Wong K, Downs J, Pizzorusso T, Ultanir S, Leonard H, Yu H, Millar DS, Istvan N, Mazarakis ND, Giovanni SD

Cyclin-dependent-like kinase 5 is required for pain signaling in human sensory neurons and mouse models

Sci Transl Med , 2020 Jul 8; 12(551):eaax4846. Epub 2020 Jul 8

PubMed ID: 32641489 DOI: 10.1126/scitranslmed.aax4846

Balestra D, Giorgio D, Bizzotto M, Fazzari M, Ben Zeev B, Pinotti M, Landsberger N, Frasca A

Splicing Mutations Impairing CDKL5 Expression and Activity Can be Efficiently Rescued by U1snRNA-Based Therapy

Int J Mol Sci , 2019 Aug 24; 20(17):4130. Epub 2019 Aug 24

PubMed ID: 31450582 DOI: 10.3390/ijms20174130

Fazzari M, Frasca A, Bifari F, Landsberger N

Aminoglycoside drugs induce efficient read-through of CDKL5 nonsense mutations, slightly restoring its kinase activity

RNA Biol , 2019 Jun 23; 16(10):1414-1423. Epub 2019 Jun 23

PubMed ID: 31232219 DOI: 10.1080/15476286.2019.1632633

Baltussen LL, Negraes PD, Silvestre M, Claxton S, Moeskops M, Christodoulou E, Flynn HR, Snijders AP, Muotri AR, Ultanir SK

Chemical genetic identification of CDKL5 substrates reveals its role in neuronal microtubule dynamics

EMBO J , 2018 Sep 28; 37(24):e99763. Epub 2018 Sep 28

PubMed ID: 30266824 DOI: 10.15252/embj.201899763

Barbiero I, Valente D, Chandola C, Magi F, Bergo A, Monteonofrio L, Tramarin M, Fazzari M, Soddu S, Landsberger N, Rinaldo C, Kilstrup-Nielsen C

CDKL5 localizes at the centrosome and midbody and is required for faithful cell division

Sci Rep , 2017 Jul 24; 7:6228. Epub 2017 Jul 24

PubMed ID: 28740074 DOI: 10.1038/s41598-017-05875-z

Mohammad Sarfaraz Nawaz, Elisa Giarda, Francesco Bedogni, Paolo La Montanara, Sara Ricciardi, Dalila Ciceri, Tiziana Alberio, Nicoletta Landsberger, Laura Rusconi, Charlotte Kilstrup-Nielsen

CDKL5 and Shootin1 Interact and Concur in Regulating Neuronal Polarization

PLOS ONE , February 05, 2016

PubMed ID: 0 DOI: 10.1371/journal.pone.0148634

La Montanara P, Rusconi L, Locarno A, Forti L, Barbiero I, Tramarin M, Chandola C, Kilstrup-Nielsen C, Landsberger N

Synaptic Synthesis, Dephosphorylation, and Degradation: A NOVEL PARADIGM FOR AN ACTIVITY-DEPENDENT NEURONAL CONTROL OF CDKL5

J Biol Chem , 2015/02/13; 290(7):4512-4527. Epub 2014 Jan 2

PubMed ID: 25555910 DOI: 10.1074/jbc.M114.589762

Ricciardi S, Ungaro F, Hambrock M, Rademacher N, Stefanelli G, Brambilla D, Sessa A, Magagnotti C, Bachi A, Giarda E, Verpelli C, Kilstrup-Nielsen C, Sala C, Kalscheuer VM, Broccoli V

CDKL5 ensures excitatory synapse stability by reinforcing NGL-1-PSD95 interaction in the postsynaptic compartment and is impaired in patient iPSC-derived neurons.

Nat Cell Biol , 2012 Sep; 14(9):911-23. Epub 2012 Aug 26

PubMed ID: 22922712 DOI: 10.1038/ncb2566

Did we miss your publication?

Have you published using HPA002847? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch