Anti-CDCA7 Antibody

cell division cycle associated 7
Recommended Applications
Product Description
Polyclonal Antibody against Human CDCA7
Alternative Gene Names
FLJ14736, JPO1
Price
$437.00
Product Number
HPA005565
Unit Size
100 µl
Concentration
Lot dependent
Availability
5 in Stock
Ships
Ready to Ship
Target protein
cell division cycle associated 7
Target gene
CDCA7
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PKFRSDISEELANVFYEDSDNESFCGFSESEVQDVLDHCGFLQKPRPDVTNELAGIFHADSDDESFCGFSESEIQDGM
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000055612 (38%)

Rat ENSRNOG00000005410 (34%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Protein Name
cell division cycle associated 7
Gene Name
CDCA7
Alternative Gene Names
FLJ14736, JPO1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000144354 on the Human Protein Atlas

Cheng C, Zhou Y, Li H, Xiong T, Li S, Bi Y, Kong P, Wang F, Cui H, Li Y, Fang X, Yan T, Li Y, Wang J, Yang B, Zhang L, Jia Z, Song B, Hu X, Yang J, Qiu H, Zhang G, Liu J, Xu E, Shi R, Zhang Y, Liu H, He C, Zhao Z, Qian Y, Rong R, Han Z, Zhang Y, Luo W, Wang J, Peng S, Yang X, Li X, Li L, Fang H, Liu X, Ma L, Chen Y, Guo S, Chen X, Xi Y, Li G, Liang J, Yang X, Guo J, Jia J, Li Q, Cheng X, Zhan Q, Cui Y

Whole-Genome Sequencing Reveals Diverse Models of Structural Variations in Esophageal Squamous Cell Carcinoma

Am J Hum Genet , 2016 Jan 28; 98(2):256-274. Epub 2016 Jan 28

PubMed ID: 26833333 DOI: 10.1016/j.ajhg.2015.12.013

Gill RM, Gabor TV, Couzens AL, Scheid MP

The MYC-Associated Protein CDCA7 Is Phosphorylated by AKT To Regulate MYC-Dependent Apoptosis and Transformation

Mol Cell Biol , 2013 Feb; 33(3):498-513

PubMed ID: 23166294 DOI: 10.1128/MCB.00276-12

Shubbar E, Kovács A, Hajizadeh S, Parris TZ, Nemes S, Gunnarsdóttir K, Einbeigi Z, Karlsson P, Helou K

Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome

BMC Cancer , 2013 Jan 2; 13:1. Epub 2013 Jan 2

PubMed ID: 23282137 DOI: 10.1186/1471-2407-13-1

Did we miss your publication?

Have you published using HPA005565? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch