Polyclonal Anti-CDC5L Antibody

cell division cycle 5-like
Recommended Applications
Product Description
Polyclonal Antibody against Human CDC5L
Alternative Gene Names
CDC5, CEF1, hCDC5, PCDC5RP
Price
$459.00
Product Number
HPA011361
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
cell division cycle 5-like
Target Gene
CDC5L
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000023932 (99%)

Rat ENSRNOG00000019975 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
cell division cycle 5-like
Gene Name
CDC5L
Alternative Gene Names
CDC5, CEF1, hCDC5, PCDC5RP
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000096401 on the Human Protein Atlas

Jokoji G, Maeda S, Oishi K, Ijuin T, Nakajima M, Tawaratsumida H, Kawamura I, Tominaga H, Taketomi E, Ikegawa S, Taniguchi N

CDC5L promotes early chondrocyte differentiation and proliferation by modulating pre-mRNA splicing of SOX9, COL2A1, and WEE1

J Biol Chem , 2021 Jul 21; 297(2):100994. Epub 2021 Jul 21

PubMed ID: 34298017 DOI: 10.1016/j.jbc.2021.100994

Martinez-Gil L, Vera-Velasco NM, Mingarro I

Exploring the Human-Nipah Virus Protein-Protein Interactome

J Virol , 2017 Nov 14; 91(23):e01461-17. Epub 2017 Nov 14

PubMed ID: 28904190 DOI: 10.1128/JVI.01461-17

Did we miss your publication?

Have you published using HPA011361? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch