Enhanced Validation

Anti-CD55 Antibody

CD55 molecule, decay accelerating factor for complement (Cromer blood group)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CD55
Alternative Gene Names
CR, CROM, DAF, TC
Price
$445.00
Product Number
HPA024386
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
CD55 molecule, decay accelerating factor for complement (Cromer blood group)
Target Gene
CD55
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000026401 (53%)

Rat ENSRNOG00000003927 (50%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
CD55 molecule, decay accelerating factor for complement (Cromer blood group)
Gene Name
CD55
Alternative Gene Names
CR, CROM, DAF, TC
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000196352 on the Human Protein Atlas

Cimmino F, Avitabile M, Pezone L, Scalia G, Montanaro D, Andreozzi M, Terracciano L, Iolascon A, Capasso M

CD55 is a HIF-2α marker with anti-adhesive and pro-invading properties in neuroblastoma

Oncogenesis , 2016 Apr 4; 5(4):e212-. Epub 2016 Apr 4

PubMed ID: 27043658 DOI: 10.1038/oncsis.2016.20

Izuhara L, Tatsumi N, Miyagawa S, Iwai S, Watanabe M, Yamanaka S, Katsuoka Y, Nagashima H, Okano HJ, Yokoo T

Generation of a Felinized Swine Endothelial Cell Line by Expression of Feline Decay-Accelerating Factor

PLoS One , 2015; 10(2):e0117682. Epub 2015 Feb 11

PubMed ID: 25671605 DOI: 10.1371/journal.pone.0117682

Did we miss your publication?

Have you published using HPA024386? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch