Polyclonal Anti-CD276 Antibody

CD276 molecule
Recommended Applications
Product Description
Polyclonal Antibody against Human CD276
Alternative Gene Names
B7-H3, B7H3, B7RP-2
Price
$505.00
Product Number
HPA017139
Unit Size
Concentration
Lot dependent
Availability
3 in Stock
Ships
Ready to Ship
Target Protein
CD276 molecule
Target Gene
CD276
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000035914 (89%)

Rat ENSRNOG00000033608 (89%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
CD276 molecule
Gene Name
CD276
Alternative Gene Names
B7-H3, B7H3, B7RP-2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000103855 on the Human Protein Atlas

Zhang C, Zhang Z, Li F, Shen Z, Qiao Y, Li L, Liu S, Song M, Zhao X, Ren F, He Q, Yang B, Fan R, Zhang Y

Large-scale analysis reveals the specific clinical and immune features of B7-H3 in glioma

Oncoimmunology , 2018 Aug 23; 7(11):e1461304. Epub 2018 Aug 23

PubMed ID: 30377558 DOI: 10.1080/2162402X.2018.1461304

Lemke D, Pfenning PN, Sahm F, Klein AC, Kempf T, Warnken U, Schnölzer M, Tudoran R, Weller M, Platten M, Wick W

Costimulatory protein 4IgB7H3 drives the malignant phenotype of glioblastoma by mediating immune escape and invasiveness.

Clin Cancer Res , 2012 Jan 1; 18(1):105-17. Epub 2011 Nov 11

PubMed ID: 22080438 DOI: 10.1158/1078-0432.CCR-11-0880

Did we miss your publication?

Have you published using HPA017139? Please let us know and we will be happy to include your reference on this page.

Read more

User Data, Western Blot KO, Customer Submission

Contribution from Undisclosed customer — April 26, 2018

Western blot using Anti-CD276 (B7-H3) antibody (HPA017139) in U2OS human bone osteosarcoma parental cell line and B7-H3 knockout (KO) U2OS cell line.

hpa017139_wb_ko

Western blot shows lysates of U2OS human bone osteosarcoma parental cell line and B7-H3 knockout (KO) U2OS cell line.

PVDF membrane was probed with 0.5 ug/mL of Anti-CD276 (B7-H3) antibody (HPA017139). A specific band was detected for B7-H3 at approximately 95 kDa (as indicated) in the parental U2OS cell line, whereas in the knockout U2OS cell line no band was detected

The experiment was conducted under reducing conditions.

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch