Enhanced Validation

Anti-CD247 Antibody

CD247 molecule
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CD247
Alternative Gene Names
CD3H, CD3Q, CD3Z
Price
$437.00
Product Number
HPA008750
Unit Size
100 µl
Concentration
Lot dependent
Availability
3 in Stock
Ships
Ready to Ship
Target protein
CD247 molecule
Target gene
CD247
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000003298 (89%)

Mouse ENSMUSG00000005763 (83%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
CD247 molecule
Gene Name
CD247
Alternative Gene Names
CD3H, CD3Q, CD3Z
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000198821 on the Human Protein Atlas

Ang WX, Li Z, Chi Z, Du SH, Chen C, Tay JC, Toh HC, Connolly JE, Xu XH, Wang S

Intraperitoneal immunotherapy with T cells stably and transiently expressing anti-EpCAM CAR in xenograft models of peritoneal carcinomatosis

Oncotarget , 2017 Jan 10; 8(8):13545-13559. Epub 2017 Jan 10

PubMed ID: 28088790 DOI: 10.18632/oncotarget.14592

Grundy S, Plumb J, Lea S, Kaur M, Ray D, Singh D

Down Regulation of T Cell Receptor Expression in COPD Pulmonary CD8 Cells

PLoS One , 2013; 8(8):e71629. Epub 2013 Aug 19

PubMed ID: 23977094 DOI: 10.1371/journal.pone.0071629

Did we miss your publication?

Have you published using HPA008750? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch