1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-CD14
Enhanced Validation

Anti-CD14 Antibody

CD14 molecule
References (4)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human CD14
Open Datasheet
Price
$445.00
Product Number
HPA002127
Unit Size
Concentration
Lot dependent
Availability
1 in Stock
Ships
Ready to Ship
Show all images
[7 pictures]
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA002127 antibody. Corresponding CD14 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis using Anti-CD14 antibody HPA002127 (A) shows similar pattern to independent antibody HPA001887 (B).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
CD14 molecule
Target Gene
CD14
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQG
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000051439 (65%)

Rat ENSRNOG00000017819 (63%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-CD14 HPA001887.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA002127 on the Human Protein Atlas
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
CD14 molecule
Gene Name
CD14
UniProt ID
P08571
Gene (Ensembl)
ENSG00000170458
Entrez Gene ID
Entrez gene: 929
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000170458 on the Human Protein Atlas

Scalia CR, Gendusa R, Basciu M, Riva L, Tusa L, Musarò A, Veronese S, Formenti A, D’Angelo D, Ronzio AG, Cattoretti G, Bolognesi MM

Epitope Recognition in the Human–Pig Comparison Model on Fixed and Embedded Material

J Histochem Cytochem , 2015 Jun 24; 63(10):805-822. Epub 2015 Jun 24

PubMed ID: 26209082 DOI: 10.1369/0022155415597738

Bachmann J, Burté F, Pramana S, Conte I, Brown BJ, Orimadegun AE, Ajetunmobi WA, Afolabi NK, Akinkunmi F, Omokhodion S, Akinbami FO, Shokunbi WA, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk JM, Wahlgren M, Fernandez-Reyes D, Nilsson P

Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria

PLoS Pathog , 2014 Apr; 10(4):e1004038. Epub 2014 Apr 17

PubMed ID: 24743550 DOI: 10.1371/journal.ppat.1004038

Wu CC, Hsu CW, Chen CD, Yu CJ, Chang KP, Tai DI, Liu HP, Su WH, Chang YS, Yu JS

Candidate Serological Biomarkers for Cancer Identified from the Secretomes of 23 Cancer Cell Lines and the Human Protein Atlas

Mol Cell Proteomics , 2010 Jun; 9(6):1100-1117. Epub 2010 Feb 1

PubMed ID: 20124221 DOI: 10.1074/mcp.M900398-MCP200

Did we miss your publication?

Have you published using HPA002127? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-CD14 (AMAb90897)
Anti-CD14 (AMAb90898)
Anti-CD14 (HPA001887)
Corresponding Antigens
PrEST Antigen CD14 (APrEST83071)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-CD14