Enhanced Validation

Anti-CD14 Antibody

CD14 molecule
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human CD14
Price
$445.00
Product Number
HPA001887
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
CD14 molecule
Target Gene
CD14
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000051439 (57%)

Rat ENSRNOG00000017819 (55%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-CD14 HPA002127.

Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Protein Name
CD14 molecule
Gene Name
CD14
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000170458 on the Human Protein Atlas

Meinhardt G, Saleh L, Otti GR, Haider S, Velicky P, Fiala C, Pollheimer J, Knöfler M

Wingless ligand 5a is a critical regulator of placental growth and survival

Sci Rep , 2016 Jun 17; 6:28127. Epub 2016 Jun 17

PubMed ID: 27311852 DOI: 10.1038/srep28127

Hingorani P, Maas ML, Gustafson MP, Dickman P, Adams RH, Watanabe M, Eshun F, Williams J, Seidel MJ, Dietz AB

Increased CTLA-4+ T cells and an increased ratio of monocytes with loss of class II (CD14+ HLA-DRlo/neg) found in aggressive pediatric sarcoma patients

J Immunother Cancer , 2015; 3:35. Epub 2015 Aug 18

PubMed ID: 26286851 DOI: 10.1186/s40425-015-0082-0

Tarassishin L, Suh HS, Lee SC

LPS and IL-1 differentially activate mouse and human astrocytes: role of CD14

Glia , 2014 Jun; 62(6):999-1013. Epub 2014 Mar 21

PubMed ID: 24659539 DOI: 10.1002/glia.22657

Fruhwürth S, Pavelka M, Bittman R, Kovacs WJ, Walter KM, Röhrl C, Stangl H

High-density lipoprotein endocytosis in endothelial cells

World J Biol Chem , 2013 Nov 26; 4(4):131-140. Epub 2013 Nov 26

PubMed ID: 24340136 DOI: 10.4331/wjbc.v4.i4.131

Zimmermann HW, Seidler S, Nattermann J, Gassler N, Hellerbrand C, Zernecke A, Tischendorf JJ, Luedde T, Weiskirchen R, Trautwein C, Tacke F

Functional Contribution of Elevated Circulating and Hepatic Non-Classical CD14+CD16+ Monocytes to Inflammation and Human Liver Fibrosis

PLoS One , 2010 Jun 10; 5(6):e11049. Epub 2010 Jun 10

PubMed ID: 20548789 DOI: 10.1371/journal.pone.0011049

Did we miss your publication?

Have you published using HPA001887? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch