Enhanced Validation

Polyclonal Anti-CCT6A Antibody

chaperonin containing TCP1, subunit 6A (zeta 1)
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human CCT6A
Alternative Gene Names
CCT6, Cctz, HTR3, TCP20, TCPZ, TTCP20
Price
$505.00
Product Number
HPA042996
Unit Size
100 µl
Concentration
Lot dependent
Availability
6 in Stock
Ships
Ready to Ship
Target Protein
chaperonin containing TCP1, subunit 6A (zeta 1)
Target Gene
CCT6A
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000000923 (100%)

Mouse ENSMUSG00000020698 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
chaperonin containing TCP1, subunit 6A (zeta 1)
Gene Name
CCT6A
Alternative Gene Names
CCT6, Cctz, HTR3, TCP20, TCPZ, TTCP20
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000146731 on the Human Protein Atlas

Huang K, Zeng Y, Xie Y, Huang L, Wu Y

Bioinformatics analysis of the prognostic value of CCT6A and associated signalling pathways in breast cancer

Mol Med Rep , 2019 Mar 28; 19(5):4344-4352. Epub 2019 Mar 28

PubMed ID: 30942452 DOI: 10.3892/mmr.2019.10100

Did we miss your publication?

Have you published using HPA042996? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch