Anti-CCAR1 Antibody

cell division cycle and apoptosis regulator 1
Recommended Applications
Product Description
Polyclonal Antibody against Human CCAR1
Alternative Gene Names
CARP-1, CARP1, FLJ10590
Price
$445.00
Product Number
HPA007856
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
cell division cycle and apoptosis regulator 1
Target Gene
CCAR1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000000397 (94%)

Mouse ENSMUSG00000020074 (93%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
cell division cycle and apoptosis regulator 1
Gene Name
CCAR1
Alternative Gene Names
CARP-1, CARP1, FLJ10590
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000060339 on the Human Protein Atlas

Ha SY, Kim JH, Yang JW, Kim J, Kim B, Park CK

The Overexpression of CCAR1 in Hepatocellular Carcinoma Associates with Poor Prognosis

Cancer Res Treat , 2015 Oct 16; 48(3):1065-1073. Epub 2015 Oct 16

PubMed ID: 26511806 DOI: 10.4143/crt.2015.302

Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E

Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.

J Proteomics , 2012 Apr 3; 75(7):2236-51. Epub 2012 Feb 15

PubMed ID: 22361696 DOI: 10.1016/j.jprot.2012.01.030

Mulder J, Björling E, Jonasson K, Wernérus H, Hober S, Hökfelt T, Uhlén M

Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics

Mol Cell Proteomics , 2009 Jul; 8(7):1612-1622. Epub 2009 Apr 7

PubMed ID: 19351664 DOI: 10.1074/mcp.M800539-MCP200

Did we miss your publication?

Have you published using HPA007856? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch