Enhanced Validation

Polyclonal Anti-CARS Antibody

cysteinyl-tRNA synthetase
References (3)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human CARS
Alternative Gene Names
CARS1
Open Datasheet
Price
$505.00
Product Number
HPA002384
Unit Size
Concentration
Lot dependent
Availability
4 in Stock
Ships
Ready to Ship
Show all images
[6 pictures]
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-CARS antibody. Corresponding CARS RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis using Anti-CARS antibody HPA002384 (A) shows similar pattern to independent antibody HPA002383 (B).
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
cysteinyl-tRNA synthetase
Target Gene
CARS
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000010755 (79%)

Rat ENSRNOG00000020651 (79%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-CARS HPA002383.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA002384 on the Human Protein Atlas
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA002384 on the Human Protein Atlas
Protein Name
cysteinyl-tRNA synthetase
Gene Name
CARS
Alternative Gene Names
CARS1
UniProt ID
P49589
Gene (Ensembl)
ENSG00000110619
Entrez Gene ID
Entrez gene: 833
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000110619 on the Human Protein Atlas

Wang S, Chen S, Ying Y, Ma X, Shen H, Li J, Wang X, Lin Y, Liu B, Zheng X, Xie L

Comprehensive Analysis of Ferroptosis Regulators With Regard to PD-L1 and Immune Infiltration in Clear Cell Renal Cell Carcinoma

Front Cell Dev Biol , 2021 Jul 5; 9:676142. Epub 2021 Jul 5

PubMed ID: 34291048 DOI: 10.3389/fcell.2021.676142

Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E

Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.

J Proteomics , 2012 Apr 3; 75(7):2236-51. Epub 2012 Feb 15

PubMed ID: 22361696 DOI: 10.1016/j.jprot.2012.01.030

Did we miss your publication?

Have you published using HPA002384? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch