Polyclonal Anti-CA12 Antibody

carbonic anhydrase XII
References (9)
Recommended Applications
Product Description
Polyclonal Antibody against Human CA12
Alternative Gene Names
HsT18816
Open Datasheet
Price
$505.00
Product Number
HPA008773
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line RT4 shows localization to nucleus.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
carbonic anhydrase XII
Target Gene
CA12
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000032373 (88%)

Rat ENSRNOG00000017766 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
carbonic anhydrase XII
Gene Name
CA12
Alternative Gene Names
HsT18816
UniProt ID
O43570
Gene (Ensembl)
ENSG00000074410
Entrez Gene ID
Entrez gene: 771
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000074410 on the Human Protein Atlas

Lenting K, van den Heuvel CN, van Ewijk A, ElMelik D, de Boer R, Tindall E, Wei G, Kusters B, te Dorsthorst M, ter Laan M, Huynen MA, Leenders WP

Mapping actionable pathways and mutations in brain tumours using targeted RNA next generation sequencing

Acta Neuropathol Commun , 2019 Nov 20; 7:185. Epub 2019 Nov 20

PubMed ID: 31747973 DOI: 10.1186/s40478-019-0826-z

Ambrosetti D, Dufies M, Dadone B, Durand M, Borchiellini D, Amiel J, Pouyssegur J, Rioux-Leclercq N, Pages G, Burel-Vandenbos F, Mazure NM

The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma

PLoS One , 2018 Feb 26; 13(2):e0193477. Epub 2018 Feb 26

PubMed ID: 29481555 DOI: 10.1371/journal.pone.0193477

Richardson SM, Ludwinski FE, Gnanalingham KK, Atkinson RA, Freemont AJ, Hoyland JA

Notochordal and nucleus pulposus marker expression is maintained by sub-populations of adult human nucleus pulposus cells through aging and degeneration

Sci Rep , 2017 May 4; 7:1501. Epub 2017 May 4

PubMed ID: 28473691 DOI: 10.1038/s41598-017-01567-w

Lloyd MC, Cunningham JJ, Bui MM, Gillies RJ, Brown JS, Gatenby RA

Darwinian dynamics of intratumoral heterogeneity: not solely random mutations but also variable environmental selection forces

Cancer Res , 2016 Mar 23; 76(11):3136-3144. Epub 2016 Mar 23

PubMed ID: 27009166 DOI: 10.1158/0008-5472.CAN-15-2962

Vermeulen JF, Kornegoor R, van der Wall E, van der Groep P, van Diest PJ

Differential Expression of Growth Factor Receptors and Membrane-Bound Tumor Markers for Imaging in Male and Female Breast Cancer

PLoS One , 2013; 8(1):e53353. Epub 2013 Jan 4

PubMed ID: 23308200 DOI: 10.1371/journal.pone.0053353

Vermeulen JF, van Brussel AS, van der Groep P, Morsink FH, Bult P, van der Wall E, van Diest PJ

Immunophenotyping invasive breast cancer: paving the road for molecular imaging

BMC Cancer , 2012 Jun 13; 12:240. Epub 2012 Jun 13

PubMed ID: 22695343 DOI: 10.1186/1471-2407-12-240

Tafreshi NK, Bui MM, Bishop K, Lloyd MC, Enkemann SA, Lopez AS, Abrahams D, Carter BW, Vagner J, Grobmyer SR, Gillies RJ, Morse DL

Noninvasive detection of breast cancer lymph node metastasis using carbonic anhydrases IX and XII targeted imaging probes.

Clin Cancer Res , 2012 Jan 1; 18(1):207-19. Epub 2011 Oct 20

PubMed ID: 22016510 DOI: 10.1158/1078-0432.CCR-11-0238

Davidson B, Stavnes HT, Holth A, Chen X, Yang Y, Shih IeM, Wang TL

Gene expression signatures differentiate ovarian/peritoneal serous carcinoma from breast carcinoma in effusions.

J Cell Mol Med , 2011 Mar; 15(3):535-44. Epub 2010 Jan 28

PubMed ID: 20132413 DOI: 10.1111/j.1582-4934.2010.01019.x

Did we miss your publication?

Have you published using HPA008773? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-CA12 (AMAb90637)
Anti-CA12 (AMAb90639)
Anti-CA12 (HPA073203)
Corresponding Antigens
PrEST Antigen CA12 (APrEST71649)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch