1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-C4A

Anti-C4A Antibody

complement component 4A (Rodgers blood group)
References (1)
Recommended Applications
Product Description
Polyclonal Antibody against Human C4A
Alternative Gene Names
C4, C4A2, C4A3, C4A4, C4A6, C4B, C4S, CO4, CPAMD2, RG
Open Datasheet
Price
$437.00
Product Number
HPA046356
Unit Size
100 µl
Concentration
Lot dependent
Availability
7 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human urinary bladder shows positivity in plasma.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target protein
complement component 4A (Rodgers blood group)
Target gene
C4A
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEI
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000000443 (72%)

Mouse ENSMUSG00000073418 (69%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Protocols
View all protocols
Protein Name
complement component 4A (Rodgers blood group)
Gene Name
C4A
Alternative Gene Names
C4, C4A2, C4A3, C4A4, C4A6, C4B, C4S, CO4, CPAMD2, RG
UniProt ID
P0C0L4
Gene (Ensembl)
ENSG00000244731
Entrez Gene ID
Entrez gene: 720
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000244731 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA046356? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-C4A (HPA048287)
Anti-C4A (HPA050103)
Corresponding Antigens
PrEST Antigen C4A (APrEST89050)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-C4A