Polyclonal Anti-C12orf66 Antibody

chromosome 12 open reading frame 66
References (1)
Recommended Applications
Product Description
Polyclonal Antibody against Human C12orf66
Alternative Gene Names
FLJ32549
Open Datasheet
Price
$505.00
Product Number
HPA046743
Unit Size
100 µl
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Show all images
[4 pictures]
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Show all images
[1 pictures]
Western blot analysis in human cell line HDLM-2.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line MCF7 shows localization to microtubules, cytokinetic bridge & mitotic spindle.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
chromosome 12 open reading frame 66
Target Gene
C12orf66
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HHPILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSF
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000053684 (92%)

Rat ENSRNOG00000028782 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA046743 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA046743 on the Human Protein Atlas
Protein Name
chromosome 12 open reading frame 66
Gene Name
C12orf66
Alternative Gene Names
FLJ32549
UniProt ID
Q96MD2
Gene (Ensembl)
ENSG00000174206
Entrez Gene ID
Entrez gene: 144577
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000174206 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA046743? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-C12orf66 (HPA052855)
Corresponding Antigens
PrEST Antigen C12orf66 (APrEST81163)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch