Anti-BRAF Antibody

B-Raf proto-oncogene, serine/threonine kinase
Recommended Applications
Product Description
Polyclonal Antibody against Human BRAF
Alternative Gene Names
BRAF1
Price
$450.00
Product Number
HPA001328
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
B-Raf proto-oncogene, serine/threonine kinase
Target Gene
BRAF
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000002413 (93%)

Rat ENSRNOG00000010957 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
B-Raf proto-oncogene, serine/threonine kinase
Gene Name
BRAF
Alternative Gene Names
BRAF1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000157764 on the Human Protein Atlas

Cao L, Wang Z, Ma J, Chen J, Zhu H, Zhou X, Zhu Q, Dong J, Lan Q, Huang Q

Clinical characteristics and molecular pathology of skull ectopic thyroid cancer

Ann Transl Med , 2016 Dec 19; 4(23):462

PubMed ID: 28090518 DOI: 10.21037/atm.2016.12.19

Kiel C, Benisty H, Lloréns-Rico V, Serrano L

The yin–yang of kinase activation and unfolding explains the peculiarity of Val600 in the activation segment of BRAF

eLife , 2016 Jan 8; 5:e12814. Epub 2016 Jan 8

PubMed ID: 26744778 DOI: 10.7554/eLife.12814

Beltran-Sastre V, Benisty H, Burnier J, Berger I, Serrano L, Kiel C

Tuneable endogenous mammalian target complementation via multiplexed plasmid-based recombineering

Sci Rep , 2015 Nov 27; 5:17432. Epub 2015 Nov 27

PubMed ID: 26612112 DOI: 10.1038/srep17432

Did we miss your publication?

Have you published using HPA001328? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch