Polyclonal Anti-BORCS6 Antibody

BLOC-1 related complex subunit 6
References (2)
Recommended Applications
Product Description
Polyclonal Antibody against Human BORCS6
Alternative Gene Names
C17orf59, FLJ20014
Open Datasheet
Price
$505.00
Product Number
HPA045415
Unit Size
Concentration
Lot dependent
Availability
7 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunohistochemical staining of human rectum shows moderate cytoplasmic and nuclear positivity in glandular cells.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
BLOC-1 related complex subunit 6
Target Gene
BORCS6
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PTPAIPPIDPEVLRDLERLSRELGGRVDRLLRGLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELE
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000045176 (98%)

Rat ENSRNOG00000006513 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
BLOC-1 related complex subunit 6
Gene Name
BORCS6
Alternative Gene Names
C17orf59, FLJ20014
UniProt ID
Q96GS4
Gene (Ensembl)
ENSG00000196544
Entrez Gene ID
Entrez gene: 54785
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000196544 on the Human Protein Atlas

Yordanov TE, Hipolito VE, Liebscher G, Vogel GF, Stasyk T, Herrmann C, Geley S, Teis D, Botelho RJ, Hess MW, Huber LA

Biogenesis of lysosome‐related organelles complex‐1 (BORC) regulates late endosomal/lysosomal size through PIKfyve‐dependent phosphatidylinositol‐3,5‐bisphosphate

Traffic , 2019 Aug 19; 20(9):674-696. Epub 2019 Aug 19

PubMed ID: 31314175 DOI: 10.1111/tra.12679

Did we miss your publication?

Have you published using HPA045415? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-BORCS6 (HPA060791)
Corresponding Antigens
PrEST Antigen BORCS6 (APrEST83843)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch