Enhanced Validation

Polyclonal Anti-BDH1 Antibody

3-hydroxybutyrate dehydrogenase, type 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human BDH1
Alternative Gene Names
BDH, SDR9C1
Price
$505.00
Product Number
HPA030947
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
3-hydroxybutyrate dehydrogenase, type 1
Target Gene
BDH1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHL
Verified Species Reactivity
Human, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000001736 (91%)

Mouse ENSMUSG00000046598 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
3-hydroxybutyrate dehydrogenase, type 1
Gene Name
BDH1
Alternative Gene Names
BDH, SDR9C1
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000161267 on the Human Protein Atlas

Scafidi S, Jernberg J, Fiskum G, McKenna MC

Metabolism of Exogenous [2,4-13C]β-Hydroxybutyrate following Traumatic Brain Injury in 21-22-Day-Old Rats: An Ex Vivo NMR Study

Metabolites , 2022 Jul 29; 12(8):710. Epub 2022 Jul 29

PubMed ID: 36005582 DOI: 10.3390/metabo12080710

Liśkiewicz D, Liśkiewicz A, Nowacka-Chmielewska MM, Grabowski M, Pondel N, Grabowska K, Student S, Barski JJ, Małecki A

Differential Response of Hippocampal and Cerebrocortical Autophagy and Ketone Body Metabolism to the Ketogenic Diet

Front Cell Neurosci , 2021 Aug 11; 15:733607. Epub 2021 Aug 11

PubMed ID: 34456688 DOI: 10.3389/fncel.2021.733607

Stagg DB, Gillingham JR, Nelson AB, Lengfeld JE, d’Avignon DA, Puchalska P, Crawford PA

Diminished ketone interconversion, hepatic TCA cycle flux, and glucose production in D-β-hydroxybutyrate dehydrogenase hepatocyte-deficient mice

Mol Metab , 2021 Jun 8; 53:101269. Epub 2021 Jun 8

PubMed ID: 34116232 DOI: 10.1016/j.molmet.2021.101269

Did we miss your publication?

Have you published using HPA030947? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch