Enhanced Validation

Anti-BCAN Antibody

brevican
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human BCAN
Alternative Gene Names
BEHAB, CSPG7, MGC13038
Price
$445.00
Product Number
HPA007865
Unit Size
Concentration
Lot dependent
Availability
4 in Stock
Ships
Ready to Ship
Target Protein
brevican
Target Gene
BCAN
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000018798 (89%)

Mouse ENSMUSG00000004892 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Protein Name
brevican
Gene Name
BCAN
Alternative Gene Names
BEHAB, CSPG7, MGC13038
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000132692 on the Human Protein Atlas

Polisetty RV, Gautam P, Gupta MK, Sharma R, Gowda H, Renu D, Shivakumar BM, Lakshmikantha A, Mariswamappa K, Ankathi P, Purohit AK, Uppin MS, Sundaram C, Sirdeshmukh R

Microsomal membrane proteome of low grade diffuse astrocytomas: Differentially expressed proteins and candidate surveillance biomarkers

Sci Rep , 2016 Jun 1; 6:26882. Epub 2016 Jun 1

PubMed ID: 27246909 DOI: 10.1038/srep26882

Monticone M, Daga A, Candiani S, Romeo F, Mirisola V, Viaggi S, Melloni I, Pedemonte S, Zona G, Giaretti W, Pfeffer U

Identification of a novel set of genes reflecting different in vivo invasive patterns of human GBM cells

BMC Cancer , 2012 Aug 17; 12:358. Epub 2012 Aug 17

PubMed ID: 22901239 DOI: 10.1186/1471-2407-12-358

Did we miss your publication?

Have you published using HPA007865? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch