Enhanced Validation

Polyclonal Anti-BAX Antibody

BCL2-associated X protein
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human BAX
Alternative Gene Names
BCL2L4
Price
$505.00
Product Number
HPA027878
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
BCL2-associated X protein
Target Gene
BAX
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNW
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000003873 (90%)

Rat ENSRNOG00000020876 (88%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
BCL2-associated X protein
Gene Name
BAX
Alternative Gene Names
BCL2L4
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000087088 on the Human Protein Atlas

Mahmoud MF, Ali N, Mostafa I, Hasan RA, Sobeh M

Coriander Oil Reverses Dexamethasone-Induced Insulin Resistance in Rats

Antioxidants (Basel) , 2022 Feb 23; 11(3):441. Epub 2022 Feb 23

PubMed ID: 35326092 DOI: 10.3390/antiox11030441

Forika G, Kiss E, Petovari G, Danko T, Gellert AB, Krenacs T

Modulated Electro-Hyperthermia Supports the Effect of Gemcitabine Both in Sensitive and Resistant Pancreas Adenocarcinoma Cell Lines

Pathol Oncol Res , 2021 Dec 10; 27:1610048. Epub 2021 Dec 10

PubMed ID: 34955688 DOI: 10.3389/pore.2021.1610048

Turunen SP, von Nandelstadh P, Öhman T, Gucciardo E, Seashore-Ludlow B, Martins B, Rantanen V, Li H, Höpfner K, Östling P, Varjosalo M, Lehti K

FGFR4 phosphorylates MST1 to confer breast cancer cells resistance to MST1/2-dependent apoptosis

Cell Death Differ , 2019 Mar 22; 26(12):2577-2593. Epub 2019 Mar 22

PubMed ID: 30903103 DOI: 10.1038/s41418-019-0321-x

Did we miss your publication?

Have you published using HPA027878? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch