Anti-AUTS2 Antibody

autism susceptibility candidate 2
Recommended Applications
Product Description
Polyclonal Antibody against Human AUTS2
Alternative Gene Names
FBRSL2, KIAA0442
Price
$445.00
Product Number
HPA000390
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
autism susceptibility candidate 2
Target Gene
AUTS2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NSSSSVHPGPLASMPMTVGVTGIHPMNSISSLDRTRMMTPFMGISPLPGGERFPYPSFHWDPIRDPLRDPYRELDIHRRDPLGRDFLLRNDPLHRLSTPRLYEADR
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000000885 (91%)

Mouse ENSMUSG00000110939 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
autism susceptibility candidate 2
Gene Name
AUTS2
Alternative Gene Names
FBRSL2, KIAA0442
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000158321 on the Human Protein Atlas

Weisner PA, Chen CY, Sun Y, Yoo J, Kao WC, Zhang H, Baltz ET, Troy JM, Stubbs L

A Mouse Mutation That Dysregulates Neighboring Galnt17 and Auts2 Genes Is Associated with Phenotypes Related to the Human AUTS2 Syndrome

G3 (Bethesda) , 2019 Sep 25; 9(11):3891-3906. Epub 2019 Sep 25

PubMed ID: 31554716 DOI: 10.1534/g3.119.400723

Parras A, Anta H, Santos-Galindo M, Swarup V, Elorza A, Nieto-Gonzalez JL, Picó S, Hernández IH, Díaz-Hernández JI, Belloc E, Rodolosse A, Parikshak NN, Peñagarikano O, Fernández-Chacón R, Irimia M, Navarro P, Geschwind DH, Méndez R, Lucas JJ

Autism-like phenotype and risk gene-RNA deadenylation by CPEB4 mis-splicing

Nature , 2018 Aug 15; 560(7719):441-446. Epub 2018 Aug 15

PubMed ID: 30111840 DOI: 10.1038/s41586-018-0423-5

Inoue YU, Inoue T

Brain enhancer activities at the gene-poor 5p14.1 autism-associated locus

Sci Rep , 2016 Aug 9; 6:31227. Epub 2016 Aug 9

PubMed ID: 27503586 DOI: 10.1038/srep31227

Oksenberg N, Haliburton GD, Eckalbar WL, Oren I, Nishizaki S, Murphy K, Pollard KS, Birnbaum RY, Ahituv N

Genome-wide distribution of Auts2 binding localizes with active neurodevelopmental genes

Transl Psychiatry , 2014 Sep 2; 4(9):e431-. Epub 2014 Sep 2

PubMed ID: 25180570 DOI: 10.1038/tp.2014.78

Lancaster MA, Renner M, Martin CA, Wenzel D, Bicknell LS, Hurles ME, Homfray T, Penninger JM, Jackson AP, Knoblich JA

Cerebral organoids model human brain development and microcephaly

Nature , 2013 Sep 19; 501(7467):10.1038/nature1. Epub 2013 Aug 28

PubMed ID: 23995685 DOI: 10.1038/nature12517

Bedogni F, Hodge RD, Nelson BR, Frederick EA, Shiba N, Daza RA, Hevner RF

Autism susceptibility candidate 2 (Auts2) encodes a nuclear protein expressed in developing brain regions implicated in autism neuropathology

Gene Expr Patterns , 2010 Jan; 10(1):9. Epub 2009 Dec 3

PubMed ID: 19948250 DOI: 10.1016/j.gep.2009.11.005

Ek S, Andréasson U, Hober S, Kampf C, Pontén F, Uhlén M, Merz H, Borrebaeck CA

From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies.

Mol Cell Proteomics , 2006 Jun; 5(6):1072-81. Epub 2006 Mar 8

PubMed ID: 16524965 DOI: 10.1074/mcp.M600077-MCP200

Did we miss your publication?

Have you published using HPA000390? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch