Enhanced Validation

Anti-ATRX Antibody

alpha thalassemia/mental retardation syndrome X-linked
References (71)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ATRX
Alternative Gene Names
JMS, RAD54, XH2, XNP
Open Datasheet
Price
$450.00
Product Number
HPA001906
Unit Size
Concentration
Lot dependent
Availability
1 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA001906 antibody. Corresponding ATRX RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ATRX antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm and nuclear bodies.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
alpha thalassemia/mental retardation syndrome X-linked
Target Gene
ATRX
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000056703 (97%)

Mouse ENSMUSG00000031229 (96%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA001906 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA001906 on the Human Protein Atlas
Protein Name
alpha thalassemia/mental retardation syndrome X-linked
Gene Name
ATRX
Alternative Gene Names
JMS, RAD54, XH2, XNP
UniProt ID
P46100
Gene (Ensembl)
ENSG00000085224
Entrez Gene ID
Entrez gene: 546
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000085224 on the Human Protein Atlas

Kerstetter-Fogle AE, Harris PL, Brady-Kalnay SM, Sloan AE

Generation of Glioblastoma Patient-Derived Intracranial Xenografts for Preclinical Studies

Int J Mol Sci , 2020 Jul 20; 21(14):5113. Epub 2020 Jul 20

PubMed ID: 32698368 DOI: 10.3390/ijms21145113

Leventoux N, Augustus M, Azar S, Riquier S, Villemin JP, Guelfi S, Falha L, Bauchet L, Gozé C, Ritchie W, Commes T, Duffau H, Rigau V, Hugnot JP

Transformation Foci in IDH1-mutated Gliomas Show STAT3 Phosphorylation and Downregulate the Metabolic Enzyme ETNPPL, a Negative Regulator of Glioma Growth

Sci Rep , 2020 Mar 26; 10:5504. Epub 2020 Mar 26

PubMed ID: 32218467 DOI: 10.1038/s41598-020-62145-1

Ferreira MS, Sørensen MD, Pusch S, Beier D, Bouillon AS, Kristensen BW, Brümmendorf TH, Beier CP, Beier F

Alternative lengthening of telomeres is the major telomere maintenance mechanism in astrocytoma with isocitrate dehydrogenase 1 mutation

J Neurooncol , 2020 Jan 20; 147(1):1-14. Epub 2020 Jan 20

PubMed ID: 31960234 DOI: 10.1007/s11060-020-03394-y

Wang LM, Li Z, Piao YS, Cai YN, Zhang LY, Ge HJ, Xu WW, Lu DH

Clinico-neuropathological features of isocitrate dehydrogenase 2 gene mutations in lower-grade gliomas

Chin Med J (Engl) , 2019 Dec 20; 132(24):2920-2926. Epub 2019 Dec 20

PubMed ID: 31833906 DOI: 10.1097/CM9.0000000000000565

Clay MR, Pinto EM, Cline C, Tran QT, Lin T, Dyer MA, Shi L, Wu H, Pounds SB, Zambetti GP, Orr BA, Ribeiro RC

DNA Methylation Profiling Reveals Prognostically Significant Groups in Pediatric Adrenocortical Tumors: A Report From the International Pediatric Adrenocortical Tumor Registry

JCO Precis Oncol , 2019 Nov 18; 3:PO.19.00163. Epub 2019 Nov 18

PubMed ID: 32923859 DOI: 10.1200/PO.19.00163

Qadeer ZA, Valle-Garcia D, Hasson D, Sun Z, Cook A, Nguyen C, Soriano A, Ma A, Griffiths LM, Zeineldin M, Filipescu D, Jubierre L, Chowdhury A, Deevy O, Chen X, Finkelstein DB, Bahrami A, Stewart E, Federico S, Gallego S, Dekio F, Fowkes M, Meni D, Maris JM, Weiss WA, Roberts SS, Cheung NK, Jin J, Segura MF, Dyer MA, Bernstein E

ATRX in-frame fusion neuroblastoma is sensitive to EZH2 inhibition via modulation of neuronal gene signatures

Cancer Cell , 2019 Oct 17; 36(5):512-527.e9. Epub 2019 Oct 17

PubMed ID: 31631027 DOI: 10.1016/j.ccell.2019.09.002

Rodriguez FJ, Graham MK, Brosnan-Cashman JA, Barber JR, Davis C, Vizcaino MA, Palsgrove DN, Giannini C, Pekmezci M, Dahiya S, Gokden M, Noë M, Wood LD, Pratilas CA, Morris CD, Belzberg A, Blakeley J, Heaphy CM

Telomere alterations in neurofibromatosis type 1-associated solid tumors

Acta Neuropathol Commun , 2019 Aug 28; 7:139. Epub 2019 Aug 28

PubMed ID: 31462295 DOI: 10.1186/s40478-019-0792-5

Kim JH, Jang WY, Jung TY, Jung S, Kim KK, Kim HS, Kim EH, Lee MC, Moon KS, Lee KH

Recurrent Glioma With Lineage Conversion From Oligodendroglioma to Astrocytoma in Two Cases

Front Oncol , 2019 Aug 27; 9:828. Epub 2019 Aug 27

PubMed ID: 31508376 DOI: 10.3389/fonc.2019.00828

Martínez H, Nagurney M, Wang ZX, Eberhart CG, Heaphy CM, Curtis MT, Rodriguez FJ

ATRX Mutations in Pineal Parenchymal Tumors of Intermediate Differentiation

J Neuropathol Exp Neurol , 2019 May 27; 78(8):703-708. Epub 2019 May 27

PubMed ID: 31225581 DOI: 10.1093/jnen/nlz050

Chen J, Schmidt RE, Dahiya S

Pituitary Adenoma in Pediatric and Adolescent Populations

J Neuropathol Exp Neurol , 2019 Apr 26; 78(7):626-632. Epub 2019 Apr 26

PubMed ID: 31115468 DOI: 10.1093/jnen/nlz040

Yost KE, Clatterbuck Soper SF, Walker RL, Pineda MA, Zhu YJ, Ester CD, Showman S, Roschke AV, Waterfall JJ, Meltzer PS

Rapid and reversible suppression of ALT by DAXX in osteosarcoma cells

Sci Rep , 2019 Mar 14; 9:4544. Epub 2019 Mar 14

PubMed ID: 30872698 DOI: 10.1038/s41598-019-41058-8

Han M, Napier CE, Frölich S, Teber E, Wong T, Noble JR, Choi EH, Everett RD, Cesare AJ, Reddel RR

Synthetic lethality of cytolytic HSV-1 in cancer cells with ATRX and PML deficiency

J Cell Sci , 2019 Mar 14; 132(5):jcs222349. Epub 2019 Mar 14

PubMed ID: 30745338 DOI: 10.1242/jcs.222349

Steele CD, Tarabichi M, Oukrif D, Webster AP, Ye H, Fittall M, Lombard P, Martincorena I, Tarpey PS, Collord G, Haase K, Strauss SJ, Berisha F, Vaikkinen H, Dhami P, Jansen M, Behjati S, Amary MF, Tirabosco R, Feber A, Campbell PJ, Alexandrov LB, Van Loo P, Flanagan AM, Pillay N

Undifferentiated Sarcomas Develop through Distinct Evolutionary Pathways

Cancer Cell , 2019 Mar 18; 35(3):441-456.e8

PubMed ID: 30889380 DOI: 10.1016/j.ccell.2019.02.002

Liverani C, Bongiovanni A, Mercatali L, Foca F, Pieri F, De Vita A, Spadazzi C, Miserocchi G, Recine F, Riva N, Nicolini S, Severi S, Martinelli G, Ibrahim T

Grading of Neuroendocrine Carcinomas: Correlation of 68Ga-PET/CT Scan with Tissue Biomarkers

Dis Markers , 2018 Dec 2; 2018:6878409. Epub 2018 Dec 2

PubMed ID: 30627226 DOI: 10.1155/2018/6878409

D’Angelo F, Ceccarelli M, Tala, Garofano L, Zhang J, Frattini V, Caruso FP, Lewis G, Alfaro KD, Bauchet L, Berzero G, Cachia D, Cangiano M, Capelle L, de Groot J, DiMeco F, Ducray F, Farah W, Finocchiaro G, Goutagny S, Kamiya-Matsuoka C, Lavarino C, Loiseau H, Lorgis V, Marras CE, McCutcheon I, Nam DH, Ronchi S, Saletti V, Seizeur R, Slopis J, Suñol M, Vandenbos F, Varlet P, Vidaud D, Watts C, Tabar V, Reuss DE, Kim SK, Meyronet D, Mokhtari K, Salvador H, Bhat KP, Eoli M, Sanson M, Lasorella A, lavarone A

The molecular landscape of glioma in patients with Neurofibromatosis 1

Nat Med , 2018 Dec 10; 25(1):176-187. Epub 2018 Dec 10

PubMed ID: 30531922 DOI: 10.1038/s41591-018-0263-8

Kafka A, Karin-Kujundžić V, Šerman L, Bukovac A, Njirić N, Jakovčević A, Pećina-Šlaus N

Hypermethylation of Secreted Frizzled Related Protein 1 gene promoter in different astrocytoma grades

Croat Med J , 2018 Oct; 59(5):213-223

PubMed ID: 30394013 DOI: 10.3325/cmj.2018.59.213

Liu J, Zhang X, Yan X, Sun M, Fan Y, Huang Y

Significance of TERT and ATRX mutations in glioma

Oncol Lett , 2018 Oct 29; 17(1):95-102. Epub 2018 Oct 29

PubMed ID: 30655743 DOI: 10.3892/ol.2018.9634

Rodriguez FJ, Brosnan-Cashman JA, Allen SJ, Adelita Vizcaino M, Giannini C, Camelo-Piragua S, Webb M, Matsushita M, Wadhwani N, Tabbarah A, Hamideh D, Jiang L, Chen L, Arvanitis LD, Alnajar HH, Barber JR, Rodríguez-Velasco A, Orr B, Heaphy CM

ALTERNATIVE LENGTHENING OF TELOMERES, ATRX LOSS AND H3-K27M MUTATIONS IN HISTOLOGICALLY DEFINED PILOCYTIC ASTROCYTOMA WITH ANAPLASIA

Brain Pathol , 2018 Oct 17; 29(1):126-140. Epub 2018 Oct 17

PubMed ID: 30192422 DOI: 10.1111/bpa.12646

Adelita Vizcaino M, Palsgrove DN, Yuan M, Giannini C, Cabrera-Aldana EE, Pallavajjala A, Burger PC, Rodriguez FJ

GRANULAR CELL ASTROCYTOMA: AN AGGRESSIVE IDH-WILDTYPE DIFFUSE GLIOMA WITH MOLECULAR GENETIC FEATURES OF PRIMARY GLIOBLASTOMA

Brain Pathol , 2018 Oct 10; 29(2):193-204. Epub 2018 Oct 10

PubMed ID: 30222900 DOI: 10.1111/bpa.12657

Brosnan-Cashman JA, Yuan M, Graham MK, Rizzo AJ, Myers KM, Davis C, Zhang R, Esopi DM, Raabe EH, Eberhart CG, Heaphy CM, Meeker AK

ATRX loss induces multiple hallmarks of the alternative lengthening of telomeres (ALT) phenotype in human glioma cell lines in a cell line-specific manner

PLoS One , 2018 Sep 18; 13(9):e0204159. Epub 2018 Sep 18

PubMed ID: 30226859 DOI: 10.1371/journal.pone.0204159

Li N, Zhang Y, Sidlauskas K, Ellis M, Evans I, Frankel P, Lau J, El-Hassan T, Guglielmi L, Broni J, Richard-Loendt A, Brandner S

Inhibition of GPR158 by microRNA-449a suppresses neural lineage of glioma stem/progenitor cells and correlates with higher glioma grades

Oncogene , 2018 May 3; 37(31):4313-4333. Epub 2018 May 3

PubMed ID: 29720725 DOI: 10.1038/s41388-018-0277-1

Diplas BH, He X, Brosnan-Cashman JA, Liu H, Chen LH, Wang Z, Moure CJ, Killela PJ, Loriaux DB, Lipp ES, Greer PK, Yang R, Rizzo AJ, Rodriguez FJ, Friedman AH, Friedman HS, Wang S, He Y, McLendon RE, Bigner DD, Jiao Y, Waitkus MS, Meeker AK, Yan H

The genomic landscape of TERT promoter wildtype-IDH wildtype glioblastoma

Nat Commun , 2018 May 25; 9:2087. Epub 2018 May 25

PubMed ID: 29802247 DOI: 10.1038/s41467-018-04448-6

Lu HC, Eulo V, Apicelli AJ, Pekmezci M, Tao Y, Luo J, Hirbe AC, Dahiya S

Aberrant ATRX protein expression is associated with poor overall survival in NF1-MPNST

Oncotarget , 2018 May 1; 9(33):23018-23028. Epub 2018 May 1

PubMed ID: 29796169 DOI: 10.18632/oncotarget.25195

Masui K, Komori T, Kato Y, Masutomi K, Ichimura K, Ogasawara S, Kaneko MK, Oki H, Suzuki H, Nitta M, Maruyama T, Muragaki Y, Kawamata T, Sawada T, Shibata N

Elevated TERT Expression in TERT-Wildtype Adult Diffuse Gliomas: Histological Evaluation with a Novel TERT-Specific Antibody

Biomed Res Int , 2018 Mar 5; 2018:7945845. Epub 2018 Mar 5

PubMed ID: 29693015 DOI: 10.1155/2018/7945845

Fereidouni F, Harmany ZT, Tian M, Todd A, Kintner JA, McPherson JD, Borowsky AD, Lechpammer M, Bishop J, Demos SG, Levenson R

Microscopy with ultraviolet surface excitation for rapid slide-free histology

Nat Biomed Eng , 2017 Dec 4; 1:957-966. Epub 2017 Dec 4

PubMed ID: 30416866

Valentini MC, Mellai M, Annovazzi L, Melcarne A, Denysenko T, Cassoni P, Casalone C, Maurella C, Grifoni S, Fania P, Cistaro A, Schiffer D

Comparison among conventional and advanced MRI, 18F-FDG PET/CT, phenotype and genotype in glioblastoma

Oncotarget , 2017 Oct 4; 8(53):91636-91653. Epub 2017 Oct 4

PubMed ID: 29207673 DOI: 10.18632/oncotarget.21482

Hayes J, Yu Y, Jalbert LE, Mazor T, Jones LE, Wood MD, Walsh KM, Bengtsson H, Hong C, Oberndorfer S, Roetzer T, Smirnov IV, Clarke JL, Aghi MK, Chang SM, Nelson SJ, Woehrer A, Phillips JJ, Solomon DA, Costello JF

Genomic analysis of the origins and evolution of multicentric diffuse lower-grade gliomas

Neuro Oncol , 2017 Oct 25; 20(5):632-641. Epub 2017 Oct 25

PubMed ID: 29077933 DOI: 10.1093/neuonc/nox205

Li X, Wei J, Liu Y, Li P, Fan L, Wang Y, Li M, Zhao D, Yu Z, Ye J, Guo Y, Yan Q, Guo S, Wang Z

Primary Astrocytic Tumours and Paired Recurrences have Similar Biological Features in IDH1, TP53 and TERTp Mutation and MGMT, ATRX Loss

Sci Rep , 2017 Oct 12; 7:13038. Epub 2017 Oct 12

PubMed ID: 29026176 DOI: 10.1038/s41598-017-13272-9

Kim SI, Lee Y, Won JK, Park CK, Choi SH, Park SH

Reclassification of Mixed Oligoastrocytic Tumors Using a Genetically Integrated Diagnostic Approach

J Pathol Transl Med , 2017 Sep 29; 52(1):28-36. Epub 2017 Sep 29

PubMed ID: 28958143 DOI: 10.4132/jptm.2017.09.25

Lee Y, Koh J, Kim SI, Won JK, Park CK, Choi SH, Park SH

The frequency and prognostic effect of TERT promoter mutation in diffuse gliomas

Acta Neuropathol Commun , 2017 Aug 29; 5:62. Epub 2017 Aug 29

PubMed ID: 28851427 DOI: 10.1186/s40478-017-0465-1

Rosager AM, Sørensen MD, Dahlrot RH, Boldt HB, Hansen S, Lathia JD, Kristensen BW

Expression and prognostic value of JAM-A in gliomas

J Neurooncol , 2017 Jul 4; 135(1):107-117. Epub 2017 Jul 4

PubMed ID: 28677106 DOI: 10.1007/s11060-017-2555-0

Pratt D, Pittaluga S, Palisoc M, Fetsch P, Xi L, Raffeld M, Gilbert MR, Quezado M

Expression of CD70 (CD27L) Is Associated With Epithelioid and Sarcomatous Features in IDH-Wild-Type Glioblastoma

J Neuropathol Exp Neurol , 2017 Jul 13; 76(8):697-708. Epub 2017 Jul 13

PubMed ID: 28789475 DOI: 10.1093/jnen/nlx051

Cleven AH, Suijker J, Agrogiannis G, Briaire-de Bruijn IH, Frizzell N, Hoekstra AS, Wijers-Koster PM, Cleton-Jansen AM, Bovée JV

IDH1 or -2 mutations do not predict outcome and do not cause loss of 5-hydroxymethylcytosine or altered histone modifications in central chondrosarcomas

Clin Sarcoma Res , 2017 May 4; 7:8. Epub 2017 May 4

PubMed ID: 28484589 DOI: 10.1186/s13569-017-0074-6

Murnyák B, Kouhsari MC, Hershkovitch R, Kálmán B, Marko-Varga G, Klekner Á, Hortobágyi T

PARP1 expression and its correlation with survival is tumour molecular subtype dependent in glioblastoma

Oncotarget , 2017 May 19; 8(28):46348-46362. Epub 2017 May 19

PubMed ID: 28654422 DOI: 10.18632/oncotarget.18013

Park JK, Paik WH, Lee K, Ryu JK, Lee SH, Kim YT

DAXX/ATRX and MEN1 genes are strong prognostic markers in pancreatic neuroendocrine tumors

Oncotarget , 2017 May 18; 8(30):49796-49806. Epub 2017 May 18

PubMed ID: 28591701 DOI: 10.18632/oncotarget.17964

VandenBussche CJ, Allison DB, Graham MK, Charu V, Lennon AM, Wolfgang CL, Hruban RH, Heaphy CM

Alternative lengthening of telomeres and ATRX/DAXX loss can reliably be detected in fine needle aspirates of pancreatic neuroendocrine tumors

Cancer , 2017 Apr 3; 125(7):544-551. Epub 2017 Apr 3

PubMed ID: 28371511 DOI: 10.1002/cncy.21857

Kiviniemi A, Gardberg M, Kivinen K, Posti JP, Vuorinen V, Sipilä J, Rahi M, Sankinen M, Minn H

Somatostatin receptor 2A in gliomas: Association with oligodendrogliomas and favourable outcome

Oncotarget , 2017 Apr 13; 8(30):49123-49132. Epub 2017 Apr 13

PubMed ID: 28467778 DOI: 10.18632/oncotarget.17097

Mohamed A, Romano D, Saveanu A, Roche C, Albertelli M, Barbieri F, Brue T, Niccoli P, Delpero JR, Garcia S, Ferone D, Florio T, Moutardier V, Poizat F, Barlier A, Gerard C

Anti-proliferative and anti-secretory effects of everolimus on human pancreatic neuroendocrine tumors primary cultures: is there any benefit from combination with somatostatin analogs?

Oncotarget , 2017 Apr 10; 8(25):41044-41063. Epub 2017 Apr 10

PubMed ID: 28454119 DOI: 10.18632/oncotarget.17008

Komori T, Nitta M, Maruyama T, Muragaki Y, Kawamata T

P03.10 Combined immunohistochemistry for IDH1R132H, p53 and ATRX improves the molecular classification of diffuse gliomas in adults

Neuro Oncol , 2017 Apr 19; 19(Suppl 3):iii35. Epub 2017 Apr 19

PubMed ID: 0 DOI: 10.1093/neuonc/nox036.125

Pekmezci M, Rice T, Molinaro AM, Walsh KM, Decker PA, Hansen H, Sicotte H, Kollmeyer TM, McCoy LS, Sarkar G, Perry A, Giannini C, Tihan T, Berger MS, Wiemels JL, Bracci PM, Eckel-Passow JE, Lachance DH, Clarke J, Taylor JW, Luks T, Wiencke JK, Jenkins RB RB, Wrensch MR

Adult Infiltrating Gliomas with WHO 2016 Integrated Diagnosis: Additional Prognostic Roles of ATRX and TERT

Acta Neuropathol , 2017 Mar 2; 133(6):1001-1016. Epub 2017 Mar 2

PubMed ID: 28255664 DOI: 10.1007/s00401-017-1690-1

Broniscer A, Hwang SN, Chamdine O, Lin T, Pounds S, Onar-Thomas A, Chi L, Shurtleff S, Allen S, Gajjar A, Northcott P, Orr BA

Bithalamic Gliomas May Be Molecularly Distinct From Their Unilateral High-Grade Counterparts

Brain Pathol , 2017 Mar 12; 28(1):112-120. Epub 2017 Mar 12

PubMed ID: 28032389 DOI: 10.1111/bpa.12484

Kim JY, Brosnan-Cashman JA, An S, Kim SJ, Song KB, Kim MS, Kim MJ, Hwang DW, Meeker AK, Yu E, Kim SC, Hruban RH, Heaphy CM, Hong SM

Alternative lengthening of telomeres in primary pancreatic neuroendocrine neoplasms is associated with aggressive clinical behavior and poor survival

Clin Cancer Res , 2016 Sep 23; 23(6):1598-1606. Epub 2016 Sep 23

PubMed ID: 27663587 DOI: 10.1158/1078-0432.CCR-16-1147

Deeg KI, Chung I, Bauer C, Rippe K

Cancer Cells with Alternative Lengthening of Telomeres Do Not Display a General Hypersensitivity to ATR Inhibition

Front Oncol , 2016 Aug 23; 6:186. Epub 2016 Aug 23

PubMed ID: 27602331 DOI: 10.3389/fonc.2016.00186

Li YX, Shi Z, Aibaidula A, Chen H, Tang Q, Li KK, Chung NY, Chan DT, Poon WS, Mao Y, Wu J, Zhou L, Chan AK, Ng HK

Not all 1p/19q non-codeleted oligodendroglial tumors are astrocytic

Oncotarget , 2016 Aug 18; 7(40):64615-64630. Epub 2016 Aug 18

PubMed ID: 27556304 DOI: 10.18632/oncotarget.11378

Vinagre J, Nabais J, Pinheiro J, Batista R, Oliveira RC, Gonçalves AP, Pestana A, Reis M, Mesquita B, Pinto V, Lyra J, Cipriano MA, Ferreira MG, Lopes JM, Sobrinho-Simões M, Soares P

TERT promoter mutations in pancreatic endocrine tumours are rare and mainly found in tumours from patients with hereditary syndromes

Sci Rep , 2016 Jul 14; 6:29714. Epub 2016 Jul 14

PubMed ID: 27411289 DOI: 10.1038/srep29714

Singhi AD, Liu TC, Roncaioli JL, Cao D, Zeh HJ, Zureikat AH, Tsung A, Marsh JW, Lee KK, Hogg ME, Bahary N, Brand RE, McGrath KM, Slivka A, Cressman KL, Fuhrer K, O’Sullivan RJ

Alternative Lengthening of Telomeres and Loss of DAXX/ATRX Expression Predicts Metastatic Disease and Poor Survival in Patients with Pancreatic Neuroendocrine Tumors

Clin Cancer Res , 2016 Jul 12; 23(2):600-609. Epub 2016 Jul 12

PubMed ID: 27407094 DOI: 10.1158/1078-0432.CCR-16-1113

Oktay Y, Ülgen E, Can Ö, Akyerli CB, Yüksel Ş, Erdemgil Y, Durası İM, Henegariu OI, Nanni EP, Selevsek N, Grossmann J, Erson-Omay EZ, Bai H, Gupta M, Lee W, Turcan Ş, Özpınar A, Huse JT, Sav MA, Flanagan A, Günel M, Sezerman OU, Yakıcıer MC, Pamir MN, Özduman K

IDH-mutant glioma specific association of rs55705857 located at 8q24.21 involves MYC deregulation

Sci Rep , 2016 Jun 10; 6:27569. Epub 2016 Jun 10

PubMed ID: 27282637 DOI: 10.1038/srep27569

Valle-García D, Qadeer ZA, McHugh DS, Ghiraldini FG, Chowdhury AH, Hasson D, Dyer MA, Recillas-Targa F, Bernstein E

ATRX binds to atypical chromatin domains at the 3′ exons of zinc finger genes to preserve H3K9me3 enrichment

Epigenetics , 2016 Mar 30; 11(6):398-414. Epub 2016 Mar 30

PubMed ID: 27029610 DOI: 10.1080/15592294.2016.1169351

Mäkinen N, Aavikko M, Heikkinen T, Taipale M, Taipale J, Koivisto-Korander R, Bützow R, Vahteristo P

Exome Sequencing of Uterine Leiomyosarcomas Identifies Frequent Mutations in TP53, ATRX, and MED12

PLoS Genet , 2016 Feb 18; 12(2):e1005850. Epub 2016 Feb 18

PubMed ID: 26891131 DOI: 10.1371/journal.pgen.1005850

Cardona AF, Rojas L, Wills B, Behaine J, Jiménez E, Hakim F, Useche N, Bermúdez S, Arrieta O, Mejía JA, Ramón JF, Carranza H, Vargas C, Otero J, González D, Rodríguez J, Ortiz LD, Cifuentes H, Balaña C

Genotyping low-grade gliomas among Hispanics

Neurooncol Pract , 2016 Jan 28; 3(3):164-172. Epub 2016 Jan 28

PubMed ID: 31386063 DOI: 10.1093/nop/npv061

Solomon DA, Wood MD, Tihan T, Bollen AW, Gupta N, Phillips JJ, Perry A

Diffuse Midline Gliomas with Histone H3-K27M Mutation: A Series of 47 Cases Assessing the Spectrum of Morphologic Variation and Associated Genetic Alterations

Brain Pathol , 2015 Dec 14; 26(5):569-580. Epub 2015 Dec 14

PubMed ID: 26517431 DOI: 10.1111/bpa.12336

Kim MM, Camelo-Piragua S, Schipper M, Tao Y, Normolle D, Junck L, Mammoser A, Betz BL, Cao Y, Kim CJ, Heth J, Sagher O, Lawrence TS, Tsien CI

Gemcitabine Plus Radiation Therapy for High Grade Glioma: Long-term Results of a Phase I Dose-Escalation Study

Int J Radiat Oncol Biol Phys , 2015 Nov 10; 94(2):305-311. Epub 2015 Nov 10

PubMed ID: 26853339 DOI: 10.1016/j.ijrobp.2015.10.032

Masayuki Yoshida, Reiko Ogawa, Hiroshi Yoshida, Akiko Maeshima, Yae Kanai, Takayuki Kinoshita, Nobuyoshi Hiraoka, Shigeki Sekine

TERT promoter mutations are frequent and show association with MED12 mutations in phyllodes tumors of the breast

British Journal of Cancer , September 10, 2015

PubMed ID: 0 DOI: 10.1038/bjc.2015.326

Uekawa K, Nakamura H, Shinojima N, Takezaki T, Yano S, Kuratsu JI

Adult Diffuse Astrocytoma in the Medulla Oblongata: Molecular Biological Analyses Including H3F3A Mutation of Histone H3.3

NMC Case Rep J , 2015 Sep 8; 3(2):29-33. Epub 2015 Sep 8

PubMed ID: 28663993 DOI: 10.2176/nmccrj.cr.2015-0012

Hayashi S, Sasaki H, Kimura T, Abe T, Nakamura T, Kitamura Y, Miwa T, Kameyama K, Hirose Y, Yoshida K

Molecular–genetic and clinical characteristics of gliomas with astrocytic appearance and total 1p19q loss in a single institutional consecutive cohort

Oncotarget , 2015 Jun 30; 6(18):15871-15881. Epub 2015 May 11

PubMed ID: 25991674 DOI: 10.18632/oncotarget.3869

Napier CE, Huschtscha LI, Harvey A, Bower K, Noble JR, Hendrickson EA, Reddel RR

ATRX represses alternative lengthening of telomeres

Oncotarget , 2015 Jun 30; 6(18):16543-16558. Epub 2015 Apr 15

PubMed ID: 26001292 DOI: 10.18632/oncotarget.3846

Reis GF, Pekmezci M, Hansen HM, Rice T, Marshall RE, Molinaro AM, Phillips JJ, Vogel H, Wiencke JK, Wrensch MR, Walsh KM, Perry A

CDKN2A Loss Is Associated with Shortened Overall Survival in Lower Grade (World Health Organization II-III) Astrocytomas

J Neuropathol Exp Neurol , 2015/05/01; 74(5):442-452

PubMed ID: 25853694 DOI: 10.1097/NEN.0000000000000188

Slatter TL, Hsia H, Samaranayaka A, Sykes P, Clow W(, Devenish CJ, Sutton T, Royds JA, PC P, Cheung AN, Hung NA

Loss of ATRX and DAXX expression identifies poor prognosis for smooth muscle tumours of uncertain malignant potential and early stage uterine leiomyosarcoma

J Pathol Clin Res , 2015 Mar 16; 1(2):95-105. Epub 2015 Mar 16

PubMed ID: 27499896 DOI: 10.1002/cjp2.11

Lauren Fishbein, Sanika Khare, Bradley Wubbenhorst, Daniel DeSloover, Kurt D’Andrea, Shana Merrill, Nam Woo Cho, Roger A. Greenberg, Tobias Else, Kathleen Montone, Virginia LiVolsi, Douglas Fraker, Robert Daber, Debbie L. Cohen, Katherine L. Nathanson

Whole-exome sequencing identifies somatic <named-entity>ATRX</named-entity> mutations in pheochromocytomas and paragangliomas

Nature Communications , 6, (2015)

PubMed ID: 25608029 DOI: 10.1038/ncomms7140

Barszczyk M, Buczkowicz P, Castelo-Branco P, Mack SC, Ramaswamy V, Mangerel J, Agnihotri S, Remke M, Golbourn B, Pajovic S, Elizabeth C, Yu M, Luu B, Morrison A, Adamski J, Nethery-Brokx K, Li XN, Van Meter T, Dirks PB, Rutka JT, Taylor MD, Tabori U, Hawkins C

Telomerase inhibition abolishes the tumorigenicity of pediatric ependymoma tumor-initiating cells

Acta Neuropathol , 2014 Dec; 128:863-877. Epub 2014 Aug 6

PubMed ID: 25120190 DOI: 10.1007/s00401-014-1327-6

Cryan JB, Haidar S, Ramkissoon LA, Bi WL, Knoff DS, Schultz N, Abedalthagafi M, Brown L, Wen PY, Reardon DA, Dunn IF, Folkerth RD, Santagata S, Lindeman NI, Ligon AH, Beroukhim R, Hornick JL, Alexander BM, Ligon KL, Ramkissoon SH

Clinical multiplexed exome sequencing distinguishes adult oligodendroglial neoplasms from astrocytic and mixed lineage gliomas

Oncotarget , 2014 Sep 30; 5(18):8083-8092. Epub 2014 Aug 12

PubMed ID: 25257301 DOI: 10.18632/oncotarget.2342

Cairncross JG, Wang M, Jenkins RB, Shaw EG, Giannini C, Brachman DG, Buckner JC, Fink KL, Souhami L, Laperriere NJ, Huse JT, Mehta MP, Curran WJ Jr

Benefit From Procarbazine, Lomustine, and Vincristine in Oligodendroglial Tumors Is Associated With Mutation of IDH

J Clin Oncol , 2014 Mar 10; 32(8):783-790. Epub 2014 Feb 10

PubMed ID: 24516018 DOI: 10.1200/JCO.2013.49.3726

Abedalthagafi M, Phillips JJ, Kim GE, Mueller S, Haas-Kogen DA, Marshall RE, Croul SE, Santi MR, Cheng J, Zhou S, Sullivan LM, Martinez-Lage M, Judkins AR, Perry A

The alternative lengthening of telomere phenotype is significantly associated with loss of ATRX expression in high-grade pediatric and adult astrocytomas: a multi-institutional study of 214 astrocytomas.

Mod Pathol , 2013 Nov; 26(11):1425-32. Epub 2013 Jun 14

PubMed ID: 23765250 DOI: 10.1038/modpathol.2013.90

Nguyen DN, Heaphy CM, de Wilde RF, Orr BA, Odia Y, Eberhart CG, Meeker AK, Rodriguez FJ

Molecular and morphologic correlates of the alternative lengthening of telomeres phenotype in high-grade astrocytomas.

Brain Pathol , 2013 May; 23(3):237-43. Epub 2012 Sep 24

PubMed ID: 22928601 DOI: 10.1111/j.1750-3639.2012.00630.x

de Wilde RF, Heaphy CM, Maitra A, Meeker AK, Edil BH, Wolfgang CL, Ellison TA, Schulick RD, Molenaar IQ, Valk GD, Vriens MR, Rinkes IH, Offerhaus GJ, Hruban RH, Matsukuma KE

Loss of ATRX or DAXX expression and concomitant acquisition of the alternative lengthening of telomeres phenotype are late events in a small subset of MEN-1 syndrome pancreatic neuroendocrine tumors

Mod Pathol , 2012 Jul; 25(7):1033-1039. Epub 2012 May 11

PubMed ID: 22575867 DOI: 10.1038/modpathol.2012.53

Jiao Y, Killela PJ, Reitman ZJ, Rasheed BA, Heaphy CM, de Wilde RF, Rodriguez FJ, Rosemberg S, Oba-Shinjo SM, Marie SK, Bettegowda C, Agrawal N, Lipp E, Pirozzi CJ, Lopez GY, He Y, Friedman HS, Friedman AH, Riggins GJ, Holdhoff M, Burger P, McLendon RE, Bigner DD, Vogelstein B, Meeker AK, Kinzler KW, Papadopoulos N, Diaz LA Jr, Yan H

Frequent ATRX, CIC, FUBP1 and IDH1 mutations refine the classification of malignant gliomas

Oncotarget , 2012 Jul; 3(7):709-722. Epub 2012 Aug 3

PubMed ID: 22869205 DOI: 10.18632/oncotarget.588

Lovejoy CA, Li W, Reisenweber S, Thongthip S, Bruno J, de Lange T, De S, Petrini JH, Sung PA, Jasin M, Rosenbluh J, Zwang Y, Weir BA, Hatton C, Ivanova E, Macconaill L, Hanna M, Hahn WC, Lue NF, Reddel RR, Jiao Y, Kinzler K, Vogelstein B, Papadopoulos N, Meeker AK, for the ALT Starr Cancer Consortium

Loss of ATRX, Genome Instability, and an Altered DNA Damage Response Are Hallmarks of the Alternative Lengthening of Telomeres Pathway

PLoS Genet , 2012; 8(7):e1002772. Epub 2012 Jul 19

PubMed ID: 22829774 DOI: 10.1371/journal.pgen.1002772

Schwartzentruber J, Korshunov A, Liu XY, Jones DT, Pfaff E, Jacob K, Sturm D, Fontebasso AM, Quang DA, Tönjes M, Hovestadt V, Albrecht S, Kool M, Nantel A, Konermann C, Lindroth A, Jäger N, Rausch T, Ryzhova M, Korbel JO, Hielscher T, Hauser P, Garami M, Klekner A, Bognar L, Ebinger M, Schuhmann MU, Scheurlen W, Pekrun A, Frühwald MC, Roggendorf W, Kramm C, Dürken M, Atkinson J, Lepage P, Montpetit A, Zakrzewska M, Zakrzewski K, Liberski PP, Dong Z, Siegel P, Kulozik AE, Zapatka M, Guha A, Malkin D, Felsberg J, Reifenberger G, von Deimling A, Ichimura K, Collins VP, Witt H, Milde T, Witt O, Zhang C, Castelo-Branco P, Lichter P, Faury D, Tabori U, Plass C, Majewski J, Pfister SM, Jabado N

Driver mutations in histone H3.3 and chromatin remodelling genes in paediatric glioblastoma.

Nature , 2012 Jan 29; 482(7384):226-31. Epub 2012 Jan 29

PubMed ID: 22286061 DOI: 10.1038/nature10833

Heaphy CM, de Wilde RF, Jiao Y, Klein AP, Edil BH, Shi C, Bettegowda C, Rodriguez FJ, Eberhart CG, Hebbar S, Offerhaus GJ, McLendon R, Rasheed BA, He Y, Yan H, Bigner DD, Oba-Shinjo SM, Marie SK, Riggins GJ, Kinzler KW, Vogelstein B, Hruban RH, Maitra A, Papadopoulos N, Meeker AK

Altered telomeres in tumors with ATRX and DAXX mutations.

Science , 2011 Jul 22; 333(6041):425. Epub 2011 Jun 30

PubMed ID: 21719641 DOI: 10.1126/science.1207313

Haberler C, Wöhrer A

Clinical Neuropathology practice news 2-2014: ATRX, a new candidate biomarker in gliomas

Clin Neuropathol , 2014 Mar-Apr; 33(2):108-111. Epub 2014 Mar 26

PubMed ID: 24559763 DOI: 10.5414/NP300758

Did we miss your publication?

Have you published using HPA001906? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-ATRX (AMAb90784)
Anti-ATRX (HPA064684)
Corresponding Antigens
PrEST Antigen ATRX (APrEST74299)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch