Polyclonal Anti-ATF3 Antibody

activating transcription factor 3
References (25)
Recommended Applications
Product Description
Polyclonal Antibody against Human ATF3
Open Datasheet
Price
$459.00
Product Number
HPA001562
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
activating transcription factor 3
Target Gene
ATF3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000003745 (92%)

Mouse ENSMUSG00000026628 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Protein Name
activating transcription factor 3
Gene Name
ATF3
UniProt ID
P18847
Gene (Ensembl)
ENSG00000162772
Entrez Gene ID
Entrez gene: 467
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000162772 on the Human Protein Atlas

Xu R, Wang J, Nie H, Zeng D, Yin C, Li Y, Wei H, Liu B, Tai Y, Hu Q, Shao X, Fang J, Liu B

Genome-Wide Expression Profiling by RNA-Sequencing in Spinal Cord Dorsal Horn of a Rat Chronic Postsurgical Pain Model to Explore Potential Mechanisms Involved in Chronic Pain

J Pain Res , 2022 Apr 5; 15:985-1001. Epub 2022 Apr 5

PubMed ID: 35411184 DOI: 10.2147/JPR.S358942

Xie G, Dong P, Chen H, Xu L, Liu Y, Ma Y, Zheng Y, Yang J, Zhou Y, Chen L, Shen L

Decreased expression of ATF3, orchestrated by β-catenin/TCF3, miR-17-5p and HOXA11-AS, promoted gastric cancer progression via increased β-catenin and CEMIP

Exp Mol Med , 2021 Nov 2; 53(11):1706-1722. Epub 2021 Nov 2

PubMed ID: 34728784 DOI: 10.1038/s12276-021-00694-9

Fan Z, Turiel G, Ardicoglu R, Ghobrial M, Masschelein E, Kocijan T, Zhang J, Tan G, Fitzgerald G, Gorski T, Alvarado-Diaz A, Gilardoni P, Adams CM, Ghesquière B, De Bock K

Exercise-induced angiogenesis is dependent on metabolically primed ATF3/4+ endothelial cells

Cell Metab , 2021 Sep 7; 33(9):1793-1807.e9

PubMed ID: 34358431 DOI: 10.1016/j.cmet.2021.07.015

Nie H, Liu B, Yin C, Chen R, Wang J, Zeng D, Tai Y, Xie J, He D, Liu B

Gene Expression Profiling of Contralateral Dorsal Root Ganglia Associated with Mirror-Image Pain in a Rat Model of Complex Regional Pain Syndrome Type-I

J Pain Res , 2021 Sep 4; 14:2739-2756. Epub 2021 Sep 4

PubMed ID: 34512013 DOI: 10.2147/JPR.S322372

Wu CH, Lu CC, Huang CL, Wu MK, Lu YY

Increased Expression of Thymic Stromal Lymphopoietin in Chronic Constriction Injury of Rat Nerve

Int J Mol Sci , 2021 Jul 1; 22(13):7105. Epub 2021 Jul 1

PubMed ID: 34281158 DOI: 10.3390/ijms22137105

Wang Z, Liu Y, Liu J, Kong N, Jiang Y, Jiang R, Zhen X, Zhou J, Li C, Sun H, Yan G

ATF3 deficiency impairs the proliferative–secretory phase transition and decidualization in RIF patients

Cell Death Dis , 2021 Apr 12; 12(4):387. Epub 2021 Apr 12

PubMed ID: 33846304 DOI: 10.1038/s41419-021-03679-8

Li Y, Yin C, Liu B, Nie H, Wang J, Zeng D, Chen R, He X, Fang J, Du J, Liang Y, Jiang Y, Fang J, Liu B

Transcriptome profiling of long noncoding RNAs and mRNAs in spinal cord of a rat model of paclitaxel-induced peripheral neuropathy identifies potential mechanisms mediating neuroinflammation and pain

J Neuroinflammation , 2021 Feb 18; 18:48. Epub 2021 Feb 18

PubMed ID: 33602238 DOI: 10.1186/s12974-021-02098-y

Robinson JA, Guenthner G, Warfield R, Kublin JR, Smith MD, Shekarabi M, Miller AD, Burdo TH

Atrophy and Death of Nonpeptidergic and Peptidergic Nociceptive Neurons in SIV Infection

Am J Pathol , 2020 Jul; 190(7):1530-1544

PubMed ID: 32246920 DOI: 10.1016/j.ajpath.2020.03.004

Cong Q, Soteros BM, Wollet M, Kim JH, Sia GM

The endogenous neuronal complement inhibitor SRPX2 protects against complement-mediated synapse elimination during development

Nat Neurosci , 2020 Jul 13; 23(9):1067-1078. Epub 2020 Jul 13

PubMed ID: 32661396 DOI: 10.1038/s41593-020-0672-0

Yin HM, Yan LF, Liu Q, Peng Z, Zhang CY, Xia Y, Su D, Gu AH, Zhou Y

Activating transcription factor 3 coordinates differentiation of cardiac and hematopoietic progenitors by regulating glucose metabolism

Sci Adv , 2020 May 6; 6(19):eaay9466. Epub 2020 May 6

PubMed ID: 32494702 DOI: 10.1126/sciadv.aay9466

Wanner R, Knöll B

Interference with SRF expression in skeletal muscles reduces peripheral nerve regeneration in mice

Sci Rep , 2020 Mar 24; 10:5281. Epub 2020 Mar 24

PubMed ID: 32210317 DOI: 10.1038/s41598-020-62231-4

Kaplan N, Wang J, Wray B, Patel P, Yang W, Peng H, Lavker RM

Single-Cell RNA Transcriptome Helps Define the Limbal/Corneal Epithelial Stem/Early Transit Amplifying Cells and How Autophagy Affects This Population

Invest Ophthalmol Vis Sci , 2019 Aug; 60(10):3570-3583

PubMed ID: 31419300 DOI: 10.1167/iovs.19-27656

Gunner G, Cheadle L, Johnson KM, Ayata P, Badimon A, Mondo E, Nagy MA, Liu L, Bemiller SM, Kim KW, Lira SA, Lamb BT, Tapper AR, Ransohoff RM, Greenberg ME, Schaefer A, Schafer DP

Sensory lesioning induces microglial synapse elimination via ADAM10 and fractalkine signaling

Nat Neurosci , 2019 Jun 17; 22(7):1075-1088. Epub 2019 Jun 17

PubMed ID: 31209379 DOI: 10.1038/s41593-019-0419-y

Inoue M, Uchida Y, Edagawa M, Hirata M, Mitamura J, Miyamoto D, Taketani K, Sekine S, Kawauchi J, Kitajima S

The stress response gene ATF3 is a direct target of the Wnt/β-catenin pathway and inhibits the invasion and migration of HCT116 human colorectal cancer cells

PLoS One , 2018 Jul 2; 13(7):e0194160. Epub 2018 Jul 2

PubMed ID: 29966001 DOI: 10.1371/journal.pone.0194160

Wang C, Tan Z, Niu B, Tsang KY, Tai A, Chan WC, Lo RL, Leung KK, Dung NW, Itoh N, Zhang MQ, Chan D, Cheah KS

Inhibiting the integrated stress response pathway prevents aberrant chondrocyte differentiation thereby alleviating chondrodysplasia

eLife , 2018 Jul 19; 7:e37673. Epub 2018 Jul 19

PubMed ID: 30024379 DOI: 10.7554/eLife.37673

Allison MB, Pan W, MacKenzie A, Patterson C, Shah K, Barnes T, Cheng W, Rupp A, Olson DP, Myers MG Jr

Defining the Transcriptional Targets of Leptin Reveals a Role for Atf3 in Leptin Action

Diabetes , 2018 Mar 13; 67(6):1093-1104. Epub 2018 Mar 13

PubMed ID: 29535089 DOI: 10.2337/db17-1395

Bueno M, Brands J, Voltz L, Fiedler K, Mays B, St. Croix C, Sembrat J, Mallampalli RK, Rojas M, Mora AL

ATF3 represses PINK1 gene transcription in lung epithelial cells to control mitochondrial homeostasis

Aging Cell , 2018 Jan 24; 17(2):e12720. Epub 2018 Jan 24

PubMed ID: 29363258 DOI: 10.1111/acel.12720

Cheng X, Liu J, Shan H, Sun L, Huang C, Yan Q, Jiang R, Ding L, Jiang Y, Zhou J, Yan G, Sun H

Activating transcription factor 3 promotes embryo attachment via up-regulation of leukemia inhibitory factor in vitro

Reprod Biol Endocrinol , 2017 Jun 2; 15:42. Epub 2017 Jun 2

PubMed ID: 28577574 DOI: 10.1186/s12958-017-0260-7

Marwarha G, Rostad S, Lilek J, Kleinjan M, Schommer J, Ghribi O

Palmitate Increases β-site AβPP-Cleavage Enzyme 1 Activity and Amyloid-β Genesis by Evoking Endoplasmic Reticulum Stress and Subsequent C/EBP Homologous Protein Activation

J Alzheimers Dis , 2017 Apr 10; 57(3):907-925. Epub 2017 Apr 10

PubMed ID: 28304295 DOI: 10.3233/JAD-161130

Gey M, Wanner R, Schilling C, Pedro MT, Sinske D, Knöll B

Atf3 mutant mice show reduced axon regeneration and impaired regeneration-associated gene induction after peripheral nerve injury

Open Biol , 2016 Aug 31; 6(8):160091. Epub 2016 Aug 31

PubMed ID: 27581653 DOI: 10.1098/rsob.160091

Edagawa M, Kawauchi J, Hirata M, Goshima H, Inoue M, Okamoto T, Murakami A, Maehara Y, Kitajima S

Role of Activating Transcription Factor 3 (ATF3) in Endoplasmic Reticulum (ER) Stress-induced Sensitization of p53-deficient Human Colon Cancer Cells to Tumor Necrosis Factor (TNF)-related Apoptosis-inducing Ligand (TRAIL)-mediated Apoptosis through Up-regulation of Death Receptor 5 (DR5) by Zerumbone and Celecoxib

J Biol Chem , 2014 Aug 1; 289(31):21544-21561. Epub 2014 Jun 17

PubMed ID: 24939851 DOI: 10.1074/jbc.M114.558890

Wei S, Wang H, Lu C, Malmut S, Zhang J, Ren S, Yu G, Wang W, Tang DD, Yan C

The Activating Transcription Factor 3 Protein Suppresses the Oncogenic Function of Mutant p53 Proteins

J Biol Chem , 2014 Mar 28; 289(13):8947-8959. Epub 2014 Feb 19

PubMed ID: 24554706 DOI: 10.1074/jbc.M113.503755

Hai T, Jalgaonkar S, Wolford CC, Yin X

Immunohistochemical Detection of Activating Transcription Factor 3, a Hub of the Cellular Adaptive–Response Network

Methods Enzymol , 2011; 490:175-194

PubMed ID: 21266251 DOI: 10.1016/B978-0-12-385114-7.00011-8

Wu X, Nguyen BC, Dziunycz P, Chang S, Brooks Y, Lefort K, Hofbauer GF, Dotto GP

Opposing roles for calcineurin and ATF3 in squamous skin cancer.

Nature , 2010 May 20; 465(7296):368-72

PubMed ID: 20485437 DOI: 10.1038/nature08996

Did we miss your publication?

Have you published using HPA001562? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-ATF3 (AMAb90909)
Corresponding Antigens
PrEST Antigen ATF3 (APrEST77475)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch