Polyclonal Anti-ASNS Antibody

asparagine synthetase (glutamine-hydrolyzing)
Recommended Applications
Product Description
Polyclonal Antibody against Human ASNS
Price
$459.00
Product Number
HPA029318
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
asparagine synthetase (glutamine-hydrolyzing)
Target Gene
ASNS
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000029752 (94%)

Rat ENSRNOG00000007546 (93%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
asparagine synthetase (glutamine-hydrolyzing)
Gene Name
ASNS
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000070669 on the Human Protein Atlas

Akahane K, Kimura S, Miyake K, Watanabe A, Kagami K, Yoshimura K, Shinohara T, Harama D, Kasai S, Goi K, Kawai T, Hata K, Kiyokawa N, Koh K, Imamura T, Horibe K, Look AT, Minegishi M, Sugita K, Takita J, Inukai T

Association of allele-specific methylation of the ASNS gene with asparaginase sensitivity and prognosis in T-ALL

Blood Adv , 2022 Jan 10; 6(1):212-224. Epub 2022 Jan 10

PubMed ID: 34535013 DOI: 10.1182/bloodadvances.2021004271

Hope HC, Brownlie RJ, Fife CM, Steele L, Lorger M, Salmond RJ

Coordination of asparagine uptake and asparagine synthetase expression modulates CD8+ T cell activation

JCI Insight , 2021 May 10; 6(9):e137761. Epub 2021 May 10

PubMed ID: 33822775 DOI: 10.1172/jci.insight.137761

Fu Y, Ding L, Yang X, Ding Z, Huang X, Zhang L, Chen S, Hu Q, Ni Y

Asparagine Synthetase-Mediated l-Asparagine Metabolism Disorder Promotes the Perineural Invasion of Oral Squamous Cell Carcinoma

Front Oncol , 2021 Mar 10; 11:637226. Epub 2021 Mar 10

PubMed ID: 33777794 DOI: 10.3389/fonc.2021.637226

Tajan M, Hennequart M, Cheung EC, Zani F, Hock AK, Legrave N, Maddocks OD, Ridgway RA, Athineos D, Suárez-Bonnet A, Ludwig RL, Novellasdemunt L, Angelis N, Li VS, Vlachogiannis G, Valeri N, Mainolfi N, Suri V, Friedman A, Manfredi M, Blyth K, Sansom OJ, Vousden KH

Serine synthesis pathway inhibition cooperates with dietary serine and glycine limitation for cancer therapy

Nat Commun , 2021 Jan 14; 12:366. Epub 2021 Jan 14

PubMed ID: 33446657 DOI: 10.1038/s41467-020-20223-y

Watanabe A, Miyake K, Nordlund J, Syvänen AC, van der Weyden L, Honda H, Yamasaki N, Nagamachi A, Inaba T, Ikawa T, Urayama KY, Kiyokawa N, Ohara A, Kimura S, Kubota Y, Takita J, Goto H, Sakaguchi K, Minegishi M, Iwamoto S, Shinohara T, Kagami K, Abe M, Akahane K, Goi K, Sugita K, Inukai T

Association of aberrant ASNS imprinting with asparaginase sensitivity and chromosomal abnormality in childhood BCP-ALL

Blood , 2020 Nov 12; 136(20):2319-2333

PubMed ID: 32573712 DOI: 10.1182/blood.2019004090

Brown D, Ryan K, Daniel Z, Mareko M, Talbot R, Moreton J, Giles TC, Emes R, Hodgman C, Parr T, Brameld JM

The Beta-adrenergic agonist, Ractopamine, increases skeletal muscle expression of Asparagine Synthetase as part of an integrated stress response gene program

Sci Rep , 2018 Oct 29; 8:15915. Epub 2018 Oct 29

PubMed ID: 30374102 DOI: 10.1038/s41598-018-34315-9

Sullivan LB, Luengo A, Danai LV, Bush LN, Diehl FF, Hosios AM, Lau AN, Elmiligy S, Malstrom S, Lewis CA, Vander Heiden MG

Aspartate is an endogenous metabolic limitation for tumour growth

Nat Cell Biol , 2018 Jun 25; 20(7):782-788. Epub 2018 Jun 25

PubMed ID: 29941931 DOI: 10.1038/s41556-018-0125-0

Hettmer S, Schinzel AC, Tchessalova D, Schneider M, Parker CL, Bronson RT, Richards NG, Hahn WC, Wagers AJ

Functional genomic screening reveals asparagine dependence as a metabolic vulnerability in sarcoma

eLife , 2015 Oct 24; 4:e09436. Epub 2015 Oct 24

PubMed ID: 26499495 DOI: 10.7554/eLife.09436

Did we miss your publication?

Have you published using HPA029318? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch