Anti-ARID5B Antibody

AT rich interactive domain 5B (MRF1-like)
Recommended Applications
Product Description
Polyclonal Antibody against Human ARID5B
Alternative Gene Names
FLJ21150, MRF2
Price
$437.00
Product Number
HPA015037
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target protein
AT rich interactive domain 5B (MRF1-like)
Target gene
ARID5B
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAPTDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRSGKPHHVRLENFRKME
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000019947 (82%)

Rat ENSRNOG00000012563 (24%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Concentration
Lot dependent
Unit Size
100 µl
Concentration
Lot dependent
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:20 - 1:50

Retrieval method: HIER pH6

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 1-4 µg/ml

Protocols
Protein Name
AT rich interactive domain 5B (MRF1-like)
Gene Name
ARID5B
Alternative Gene Names
FLJ21150, MRF2
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000150347 on the Human Protein Atlas

Leong WZ, Tan SH, Ngoc PC, Amanda S, Yam AW, Liau WS, Gong Z, Lawton LN, Tenen DG, Sanda T

ARID5B as a critical downstream target of the TAL1 complex that activates the oncogenic transcriptional program and promotes T-cell leukemogenesis

Genes Dev , 2017 Dec 1; 31(23-24):2343-2360

PubMed ID: 29326336 DOI: 10.1101/gad.302646.117

Singh B, Kinne HE, Milligan RD, Washburn LJ, Olsen M, Lucci A

Important Role of FTO in the Survival of Rare Panresistant Triple-Negative Inflammatory Breast Cancer Cells Facing a Severe Metabolic Challenge

PLoS One , 2016 Jul 8; 11(7):e0159072. Epub 2016 Jul 8

PubMed ID: 27390851 DOI: 10.1371/journal.pone.0159072

Did we miss your publication?

Have you published using HPA015037? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens