1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-AQP4
Enhanced Validation

Anti-AQP4 Antibody

aquaporin 4
References (9)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human AQP4
Alternative Gene Names
MIWC
Open Datasheet
Price
$445.00
Product Number
HPA014784
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Show all images
[7 pictures]
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA014784 antibody. Corresponding AQP4 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in human brain tissue.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target protein
aquaporin 4
Target gene
AQP4
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000024411 (93%)

Rat ENSRNOG00000016043 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in cell lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA014784 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Immunofluorescence in cell lines (ICC-IF)

All ICC-IF characterization data for HPA014784 on the Human Protein Atlas
Protein Name
aquaporin 4
Gene Name
AQP4
Alternative Gene Names
MIWC
UniProt ID
P55087
Gene (Ensembl)
ENSG00000171885
Entrez Gene ID
Entrez gene: 361
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000171885 on the Human Protein Atlas

Diéguez-Hurtado R, Kato K, Giaimo BD, Nieminen-Kelhä M, Arf H, Ferrante F, Bartkuhn M, Zimmermann T, Bixel MG, Eilken HM, Adams S, Borggrefe T, Vajkoczy P, Adams RH

Loss of the transcription factor RBPJ induces disease-promoting properties in brain pericytes

Nat Commun , 2019 Jun 27; 10:2817. Epub 2019 Jun 27

PubMed ID: 31249304 DOI: 10.1038/s41467-019-10643-w

Li F, Geng X, Yip J, Ding Y

Therapeutic Target and Cell-signal Communication of Chlorpromazine and Promethazine in Attenuating Blood–Brain Barrier Disruption after Ischemic Stroke

Cell Transplant , 2018 Dec 20; 28(2):145-156. Epub 2018 Dec 20

PubMed ID: 30569751 DOI: 10.1177/0963689718819443

Cerrato V, Parmigiani E, Figueres-Oñate M, Betizeau M, Aprato J, Nanavaty I, Berchialla P, Luzzati F, de’Sperati C, López-Mascaraque L, Buffo A

Multiple origins and modularity in the spatiotemporal emergence of cerebellar astrocyte heterogeneity

PLoS Biol , 2018 Sep 27; 16(9):e2005513. Epub 2018 Sep 27

PubMed ID: 30260948 DOI: 10.1371/journal.pbio.2005513

Rosenberg S, Simeonova I, Bielle F, Verreault M, Bance B, Le Roux I, Daniau M, Nadaradjane A, Gleize V, Paris S, Marie Y, Giry M, Polivka M, Figarella-Branger D, Aubriot-Lorton MH, Villa C, Vasiljevic A, Lechapt-Zalcman E, Kalamarides M, Sharif A, Mokhtari K, Pagnotta SM, Iavarone A, Lasorella A, Huillard E, Sanson M

A recurrent point mutation in PRKCA is a hallmark of chordoid gliomas

Nat Commun , 2018 Jun 18; 9:2371. Epub 2018 Jun 18

PubMed ID: 29915258 DOI: 10.1038/s41467-018-04622-w

Chen J, He W, Hu X, Shen Y, Cao J, Wei Z, Luan Y, He L, Jiang F, Tao Y

A role for ErbB signaling in the induction of reactive astrogliosis

Cell Discov , 2017 Dec 5; 3:17044-. Epub 2017 Dec 5

PubMed ID: 29238610 DOI: 10.1038/celldisc.2017.44

Liddelow SA, Guttenplan KA, Clarke LE, Bennett FC, Bohlen CJ, Schirmer L, Bennett ML, Münch AE, Chung WS, Peterson TC, Wilton DK, Frouin A, Napier BA, Panicker N, Kumar M, Buckwalter MS, Rowitch DH, Dawson VL, Dawson TM, Stevens B, Barres BA

Neurotoxic reactive astrocytes are induced by activated microglia

Nature , 2017 Jan 18; 541(7638):481-487. Epub 2017 Jan 18

PubMed ID: 28099414 DOI: 10.1038/nature21029

Lopez-Rodriguez AB, Acaz-Fonseca E, Viveros MP, Garcia-Segura LM

Changes in Cannabinoid Receptors, Aquaporin 4 and Vimentin Expression after Traumatic Brain Injury in Adolescent Male Mice. Association with Edema and Neurological Deficit

PLoS One , 2015; 10(6):e0128782. Epub 2015 Jun 3

PubMed ID: 26039099 DOI: 10.1371/journal.pone.0128782

Sareen D, Gowing G, Sahabian A, Staggenborg K, Paradis R, Avalos P, Latter J, Ornelas L, Garcia L, Svendsen CN

Human neural progenitor cells generated from induced pluripotent stem cells can survive, migrate, and integrate in the rodent spinal cord

J Comp Neurol , 2014 Aug 15; 522(12):2707-2728. Epub 2014 Apr 12

PubMed ID: 24610630 DOI: 10.1002/cne.23578

Did we miss your publication?

Have you published using HPA014784? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Alternative Antibodies
Anti-AQP4 (AMAb90537)
Corresponding Antigens
PrEST Antigen AQP4 (APrEST73067)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-AQP4