Enhanced Validation

Polyclonal Anti-AQP4 Antibody

aquaporin 4
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human AQP4
Alternative Gene Names
MIWC
Price
$505.00
Product Number
HPA014784
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Target Protein
aquaporin 4
Target Gene
AQP4
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Verified Species Reactivity
Human, Mouse
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000024411 (93%)

Rat ENSRNOG00000016043 (92%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
aquaporin 4
Gene Name
AQP4
Alternative Gene Names
MIWC
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000171885 on the Human Protein Atlas

Domingo-Muelas A, Duart-Abadia P, Morante-Redolat JM, Jordán-Pla A, Belenguer G, Fabra-Beser J, Paniagua-Herranz L, Pérez-Villalba A, Álvarez-Varela A, Barriga FM, Gil-Sanz C, Ortega F, Batlle E, Fariñas I

Post-transcriptional control of a stemness signature by RNA-binding protein MEX3A regulates murine adult neurogenesis

Nat Commun , 2023 Jan 23; 14:373. Epub 2023 Jan 23

PubMed ID: 36690670 DOI: 10.1038/s41467-023-36054-6

Ben-Nejma IR, Keliris AJ, Vanreusel V, Ponsaerts P, Van der Linden A, Keliris GA

Altered dynamics of glymphatic flow in a mature-onset Tet-off APP mouse model of amyloidosis

Alzheimers Res Ther , 2023 Jan 28; 15:23. Epub 2023 Jan 28

PubMed ID: 36707887 DOI: 10.1186/s13195-023-01175-z

Vasciaveo V, Iadarola A, Casile A, Dante D, Morello G, Minotta L, Tamagno E, Cicolin A, Guglielmotto M

Sleep fragmentation affects glymphatic system through the different expression of AQP4 in wild type and 5xFAD mouse models

Acta Neuropathol Commun , 2023 Jan 18; 11:16. Epub 2023 Jan 18

PubMed ID: 36653878 DOI: 10.1186/s40478-022-01498-2

Wood JP, Chidlow G, Halliday LA, Casson RJ, Selva D, Sun M

Histochemical Comparison of Human and Rat Lacrimal Glands: Implications for Bio-Engineering Studies

Transl Vis Sci Technol , 2022 Nov 14; 11(11):10. Epub 2022 Nov 14

PubMed ID: 36374486 DOI: 10.1167/tvst.11.11.10

Littau JL, Velilla L, Hase Y, Villalba‐Moreno ND, Hagel C, Drexler D, Osorio Restrepo S, Villegas A, Lopera F, Vargas S, Glatzel M, Krasemann S, Quiroz YT, Arboleda‐Velasquez JF, Kalaria R, Sepulveda‐Falla D

Evidence of beta amyloid independent small vessel disease in familial Alzheimer's disease

Brain Pathol , 2022 Jun 13; 32(6):e13097. Epub 2022 Jun 13

PubMed ID: 35695802 DOI: 10.1111/bpa.13097

Rayaprolu S, Bitarafan S, Santiago JV, Betarbet R, Sunna S, Cheng L, Xiao H, Nelson RS, Kumar P, Bagchi P, Duong DM, Goettemoeller AM, Oláh VJ, Rowan M, Levey AI, Wood LB, Seyfried NT, Rangaraju S

Cell type-specific biotin labeling in vivo resolves regional neuronal and astrocyte proteomic differences in mouse brain

Nat Commun , 2022 May 25; 13:2927. Epub 2022 May 25

PubMed ID: 35614064 DOI: 10.1038/s41467-022-30623-x

Pandit K, Petrescu J, Cuevas M, Stephenson W, Smibert P, Phatnani H, Maniatis S

An open source toolkit for repurposing Illumina sequencing systems as versatile fluidics and imaging platforms

Sci Rep , 2022 Mar 24; 12:5081. Epub 2022 Mar 24

PubMed ID: 35332182 DOI: 10.1038/s41598-022-08740-w

Ghirotto B, Oliveira DF, Cipelli M, Basso PJ, de Lima J, Breda CN, Ribeiro HC, Silva CC, Sertié AL, Oliveira AE, Hiyane MI, Caldini EG, Sussulini A, Nakaya HI, Kowaltowski AJ, Oliveira EM, Zatz M, Câmara NO

MS‐Driven Metabolic Alterations Are Recapitulated in iPSC‐Derived Astrocytes

Ann Neurol , 2022 Mar 17; 91(5):652-669. Epub 2022 Mar 17

PubMed ID: 35226368 DOI: 10.1002/ana.26336

Xu T, Li X, Guo Y, Uhlin E, Holmberg L, Mitra S, Winn D, Falk A, Sundström E

Multiple therapeutic effects of human neural stem cells derived from induced pluripotent stem cells in a rat model of post-traumatic syringomyelia

EBioMedicine , 2022 Feb 16; 77:103882. Epub 2022 Feb 16

PubMed ID: 35182996 DOI: 10.1016/j.ebiom.2022.103882

Bergström S, Öijerstedt L, Remnestål J, Olofsson J, Ullgren A, Seelaar H, van Swieten JC, Synofzik M, Sanchez-Valle R, Moreno F, Finger E, Masellis M, Tartaglia C, Vandenberghe R, Laforce R, Galimberti D, Borroni B, Butler CR, Gerhard A, Ducharme S, Rohrer JD, Månberg A, Graff C, Nilsson P, on behalf of the Genetic Frontotemporal Dementia Initiative (GENFI)JiskootLizeLRoweJames B.JBde MendonçaAlexandreATagliaviniFabrizioFSantanaIsabelILe BerIsabelleILevinJohannesJDanekAdrianAOttoMarkusMFrisoniGiovanniGGhidoniRobertaRSorbiSandroSPasquierFlorenceFJelicVesnaVAnderssonChristinCAfonsoSóniaSAlmeidaMaria RosarioMRAnderl-StraubSarahSAntonellAnnaAArchettiSilvanaSArighiAndreaABalasaMirceaMBarandiaranMyriamMBargallóNuriaNBarthaRobartRBenderBenjaminBBenussiAlbertoABenussiLuisaLBessiValentinaVBinettiGiulianoGBlackSandraSBocchettaMartinaMBorrego-EcijaSergiSBrasJoseJBruffaertsRoseRCañadaMartaMCantoniValentinaVCaroppoPaolaPCashDavidDCastelo-BrancoMiguelMConveryRhianRCopeThomasTDi FedeGiuseppeGDíezAlinaADuroDianaDFenoglioChiaraCFerrariCamillaCFerreiraCatarina B.CBFoxNickNFreedmanMorrisMFumagalliGiorgioGGabilondoAlazneAGasparottiRobertoRGauthierSergeSGazzinaStefanoSGiacconeGiorgioGGorostidiAnaAGreavesCarolineCGuerreiroRitaRHellerCarolinCHoegenTobiasTIndakoetxeaBegoñaBJiskootLizeLKarnathHans-OttoHOKerenRonRLangheinrichTobiasTLeitãoMaria JoãoMJLladóAlbertALombardiGemmaGLoosliSandraSMarutaCarolinaCMeadSimonSMeeterLiekeLMiltenbergerGabrielGvan MinkelenRickRMitchellSaraSMooreKatrinaKNacmiasBenedettaBNicholasJenniferJOlivesJaumeJOurselinSebastienSPadovaniAlessandroAPanmanJessicaJPapmaJanne M.JMPeakmanGeorgiaGPievaniMichelaMPijnenburgYolandeYPolitoCristinaCPremiEnricoEPrioniSaraSPrixCatharinaCRademakersRosaRRedaelliVeronicaVRittmanTimTRogaevaEkaterinaERosa-NetoPedroPRossiGiacominaGRosserMartinMSantiagoBeatrizBScarpiniElioESchöneckerSonjaSSemlerElisaEShafeiRachelleRShoesmithChristenCTábuas-PereiraMiguelMTaintaMikelMTaipaRicardoRTang-WaiDavidDThomasDavid L.DLThompsonPaulPThonbergHåkanHTimberlakeCarolynCTiraboschiPietroPToddEmilyEVan DammePhilipPVandenbulckeMathieuMVeldsmanMicheleMVerdelhoAnaAVillanuaJorgeJWarrenJasonJWilkeCarloCWoollacottIoneIWlasichElisabethEZetterbergHenrikHZulaicaMirenM

A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study

Mol Neurodegener , 2021 Nov 27; 16:79. Epub 2021 Nov 27

PubMed ID: 34838088 DOI: 10.1186/s13024-021-00499-4

Bergström S, Remnestål J, Yousef J, Olofsson J, Markaki I, Carvalho S, Corvol J, Kultima K, Kilander L, Löwenmark M, Ingelsson M, Blennow K, Zetterberg H, Nellgård B, Brosseron F, Heneka MT, Bosch B, Sanchez‐Valle R, Månberg A, Svenningsson P, Nilsson P

Multi‐cohort profiling reveals elevated CSF levels of brain‐enriched proteins in Alzheimer’s disease

Ann Clin Transl Neurol , 2021 Jun 15; 8(7):1456-1470. Epub 2021 Jun 15

PubMed ID: 34129723 DOI: 10.1002/acn3.51402

Rao W, Niroula S, Wang S, Vincent M, McKeon F, Xian W

Protocol for Cloning Epithelial Stem Cell Variants from Human Lung

STAR Protoc , 2020 Jul 9; 1(2):100063. Epub 2020 Jul 9

PubMed ID: 33015646 DOI: 10.1016/j.xpro.2020.100063

Barbar L, Jain T, Zimmer M, Kruglikov I, Sadick J, Wang M, Kalpana K, Rose IV, Burstein SR, Rusielewicz T, Nijsure M, Guttenplan KA, di Domenico A, Croft G, Zhang B, Nobuta H, Hébert JM, Liddelow SA, Fossati V

CD49f is a novel marker of functional and reactive human iPSC-derived astrocytes

Neuron , 2020 Jun 1; 107(3):436-453.e12. Epub 2020 Jun 1

PubMed ID: 32485136 DOI: 10.1016/j.neuron.2020.05.014

Paraiso HC, Wang X, Kuo PC, Furnas D, Scofield BA, Chang FL, Yen JH, Yu IC

Isolation of Mouse Cerebral Microvasculature for Molecular and Single-Cell Analysis

Front Cell Neurosci , 2020 Apr 9; 14:84. Epub 2020 Apr 9

PubMed ID: 32327974 DOI: 10.3389/fncel.2020.00084

Early AN, Gorman AA, Van Eldik LJ, Bachstetter AD, Morganti JM

Effects of advanced age upon astrocyte-specific responses to acute traumatic brain injury in mice

J Neuroinflammation , 2020 Apr 14; 17:115. Epub 2020 Apr 14

PubMed ID: 32290848 DOI: 10.1186/s12974-020-01800-w

Rao W, Wang S, Duleba M, Niroula S, Gollar K, Xie J, Mahalingam R, Neupane R, Liew AA, Vincent M, Okuda K, O’Neal WK, Boucher RC, Dickey BF, Wechsler ME, Ibrahim O, Engelhardt JF, Mertens TC, Wang W, Jyothula SS, Crum CP, Karmouty-Quintana H, Parekh KR, Metersky ML, McKeon FD, Xian W

Regenerative Metaplastic Clones in COPD Lung Drive Inflammation and Fibrosis

Cell , 2020 Apr 15; 181(4):848-864.e18. Epub 2020 Apr 15

PubMed ID: 32298651 DOI: 10.1016/j.cell.2020.03.047

Diéguez-Hurtado R, Kato K, Giaimo BD, Nieminen-Kelhä M, Arf H, Ferrante F, Bartkuhn M, Zimmermann T, Bixel MG, Eilken HM, Adams S, Borggrefe T, Vajkoczy P, Adams RH

Loss of the transcription factor RBPJ induces disease-promoting properties in brain pericytes

Nat Commun , 2019 Jun 27; 10:2817. Epub 2019 Jun 27

PubMed ID: 31249304 DOI: 10.1038/s41467-019-10643-w

Li F, Geng X, Yip J, Ding Y

Therapeutic Target and Cell-signal Communication of Chlorpromazine and Promethazine in Attenuating Blood–Brain Barrier Disruption after Ischemic Stroke

Cell Transplant , 2018 Dec 20; 28(2):145-156. Epub 2018 Dec 20

PubMed ID: 30569751 DOI: 10.1177/0963689718819443

Cerrato V, Parmigiani E, Figueres-Oñate M, Betizeau M, Aprato J, Nanavaty I, Berchialla P, Luzzati F, de’Sperati C, López-Mascaraque L, Buffo A

Multiple origins and modularity in the spatiotemporal emergence of cerebellar astrocyte heterogeneity

PLoS Biol , 2018 Sep 27; 16(9):e2005513. Epub 2018 Sep 27

PubMed ID: 30260948 DOI: 10.1371/journal.pbio.2005513

Rosenberg S, Simeonova I, Bielle F, Verreault M, Bance B, Le Roux I, Daniau M, Nadaradjane A, Gleize V, Paris S, Marie Y, Giry M, Polivka M, Figarella-Branger D, Aubriot-Lorton MH, Villa C, Vasiljevic A, Lechapt-Zalcman E, Kalamarides M, Sharif A, Mokhtari K, Pagnotta SM, Iavarone A, Lasorella A, Huillard E, Sanson M

A recurrent point mutation in PRKCA is a hallmark of chordoid gliomas

Nat Commun , 2018 Jun 18; 9:2371. Epub 2018 Jun 18

PubMed ID: 29915258 DOI: 10.1038/s41467-018-04622-w

Chen J, He W, Hu X, Shen Y, Cao J, Wei Z, Luan Y, He L, Jiang F, Tao Y

A role for ErbB signaling in the induction of reactive astrogliosis

Cell Discov , 2017 Dec 5; 3:17044-. Epub 2017 Dec 5

PubMed ID: 29238610 DOI: 10.1038/celldisc.2017.44

Liddelow SA, Guttenplan KA, Clarke LE, Bennett FC, Bohlen CJ, Schirmer L, Bennett ML, Münch AE, Chung WS, Peterson TC, Wilton DK, Frouin A, Napier BA, Panicker N, Kumar M, Buckwalter MS, Rowitch DH, Dawson VL, Dawson TM, Stevens B, Barres BA

Neurotoxic reactive astrocytes are induced by activated microglia

Nature , 2017 Jan 18; 541(7638):481-487. Epub 2017 Jan 18

PubMed ID: 28099414 DOI: 10.1038/nature21029

Lopez-Rodriguez AB, Acaz-Fonseca E, Viveros MP, Garcia-Segura LM

Changes in Cannabinoid Receptors, Aquaporin 4 and Vimentin Expression after Traumatic Brain Injury in Adolescent Male Mice. Association with Edema and Neurological Deficit

PLoS One , 2015; 10(6):e0128782. Epub 2015 Jun 3

PubMed ID: 26039099 DOI: 10.1371/journal.pone.0128782

Sareen D, Gowing G, Sahabian A, Staggenborg K, Paradis R, Avalos P, Latter J, Ornelas L, Garcia L, Svendsen CN

Human neural progenitor cells generated from induced pluripotent stem cells can survive, migrate, and integrate in the rodent spinal cord

J Comp Neurol , 2014 Aug 15; 522(12):2707-2728. Epub 2014 Apr 12

PubMed ID: 24610630 DOI: 10.1002/cne.23578

Did we miss your publication?

Have you published using HPA014784? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch