Anti-APTX Antibody

aprataxin
Recommended Applications
Product Description
Polyclonal Antibody against Human APTX
Alternative Gene Names
AOA, AOA1, AXA1, EAOH, EOAHA, FLJ20157
Price
$445.00
Product Number
HPA064930
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
aprataxin
Target Gene
APTX
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HMVNELYPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSNSGQCSVPLKKGKDAPIKKESLGHWSQGLKISMQDPKMQVYKD
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000028411 (69%)

Rat ENSRNOG00000006582 (60%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:1000 - 1:2500

Retrieval method: HIER pH6

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Protein Name
aprataxin
Gene Name
APTX
Alternative Gene Names
AOA, AOA1, AXA1, EAOH, EOAHA, FLJ20157
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000137074 on the Human Protein Atlas

Did we miss your publication?

Have you published using HPA064930? Please let us know and we will be happy to include your reference on this page.

Read more

User data in APTX vector transfected HCT116 cells, Customer Submission

Contribution from Diego Arango, Group of Molecular Oncology, Vall d'Hebron Hospital Research Institute — February 25, 2016

We have tested the Anti-APTX antibody (HPA064930) in formalin-fixed, paraffin embedded cells with forced overexpression of APTX. The results convincingly demonstrate the specificity of the HPA064930 antibody.

A.                                                                                                           B.

hpa064930_cells_aptx     hpa064930_cells_dox

The images show nuclear positivity in HCT116 colon cancer cells stably transfected with A) a constitutive APTX vector and B) a dox-dependent inducible APTX vector, compared to the control (HCT116 Parental and HCT116 -Dox). 

Dilution 1:10 000 after citrate HIER. 

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Corresponding Antigens

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch