Enhanced Validation

Anti-APOL1 Antibody

apolipoprotein L, 1
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human APOL1
Alternative Gene Names
APOL
Price
$445.00
Product Number
HPA018885
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Target Protein
apolipoprotein L, 1
Target Gene
APOL1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000010601 (43%)

Rat ENSRNOG00000047782 (39%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Protein Name
apolipoprotein L, 1
Gene Name
APOL1
Alternative Gene Names
APOL
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000100342 on the Human Protein Atlas

Aghajan M, Booten SL, Althage M, Hart CE, Ericsson A, Maxvall I, Ochaba J, Menschik-Lundin A, Hartleib J, Kuntz S, Gattis D, Ahlström C, Watt AT, Engelhardt JA, Monia BP, Magnone MC, Guo S

Antisense oligonucleotide treatment ameliorates IFN-γ–induced proteinuria in APOL1-transgenic mice

JCI Insight , 2019 Jun 20; 4(12):e126124. Epub 2019 Jun 20

PubMed ID: 31217349 DOI: 10.1172/jci.insight.126124

Ryu JH, Ge M, Merscher S, Rosenberg AZ, Desante M, Roshanravan H, Okamoto K, Shin MK, Hoek M, Fornoni A, Kopp JB

APOL1 renal risk variants promote cholesterol accumulation in tissues and cultured macrophages from APOL1 transgenic mice

PLoS One , 2019 Apr 18; 14(4):e0211559. Epub 2019 Apr 18

PubMed ID: 30998685 DOI: 10.1371/journal.pone.0211559

Okamoto K, Rausch JW, Wakashin H, Fu Y, Chung JY, Dummer PD, Shin MK, Chandra P, Suzuki K, Shrivastav S, Rosenberg AZ, Hewitt SM, Ray PE, Noiri E, Le Grice SF, Hoek M, Han Z, Winkler CA, Kopp JB

APOL1 risk allele RNA contributes to renal toxicity by activating protein kinase R

Commun Biol , 2018 Nov 7; 1:188. Epub 2018 Nov 7

PubMed ID: 30417125 DOI: 10.1038/s42003-018-0188-2

Cheatham AM, Davis SE, Khatua AK, Popik W

Blocking the 5′ splice site of exon 4 by a morpholino oligomer triggers APOL1 protein isoform switch

Sci Rep , 2018 Jun 7; 8:8739. Epub 2018 Jun 7

PubMed ID: 29880816 DOI: 10.1038/s41598-018-27104-x

Fontaine F, Lecordier L, Vanwalleghem G, Uzureau P, Van Reet N, Fontaine M, Tebabi P, Vanhollebeke B, Büscher P, Pérez-Morga D, Pays E

APOLs with low pH dependence can kill all African trypanosomes

Nat Microbiol , 2017 Sep 18; 2(11):1500-1506. Epub 2017 Sep 18

PubMed ID: 28924146 DOI: 10.1038/s41564-017-0034-1

Madhavan SM, O’Toole JF, Konieczkowski M, Barisoni L, Thomas DB, Ganesan S, Bruggeman LA, Buck M, Sedor JR

APOL1 variants change C-terminal conformational dynamics and binding to SNARE protein VAMP8

JCI Insight , 2017 Jul 20; 2(14):e92581. Epub 2017 Jul 20

PubMed ID: 28724794 DOI: 10.1172/jci.insight.92581

Granado D, Müller D, Krausel V, Kruzel-Davila E, Schuberth C, Eschborn M, Wedlich-Söldner R, Skorecki K, Pavenstädt H, Michgehl U, Weide T

Intracellular APOL1 Risk Variants Cause Cytotoxicity Accompanied by Energy Depletion

J Am Soc Nephrol , 2017 Jul 10; 28(11):3227-3238. Epub 2017 Jul 10

PubMed ID: 28696248 DOI: 10.1681/ASN.2016111220

Hayek SS, Koh KH, Grams ME, Wei C, Ko YA, Li J, Samelko B, Lee H, Dande RR, Lee HW, Hahm E, Peev V, Tracy M, Tardi NJ, Gupta V, Altintas MM, Garborcauskas G, Stojanovic N, Winkler CA, Lipkowitz MS, Tin A, Inker LA, Levey AS, Zeier M, Freedman BI, Kopp JB, Skorecki K, Coresh J, Quyyumi AA, Sever S, Reiser J

A tripartite complex of suPAR, APOL1 risk variants and αvβ3 integrin on podocytes mediates chronic kidney disease

Nat Med , 2017 Jun 26; 23(8):945-953. Epub 2017 Jun 26

PubMed ID: 28650456 DOI: 10.1038/nm.4362

Beckerman P, Bi-Karchin J, Park AS, Qiu C, Dummer PD, Soomro I, Boustany-Kari CM, Pullen SS, Miner JH, Hu CA, Rohacs T, Inoue K, Ishibe S, Saleem MA, Palmer MB, Cuervo AM, Kopp JB, Susztak K

Transgenic Expression of Human APOL1 Risk Variants in Podocytes Induces Kidney Disease in Mice

Nat Med , 2017 Feb 20; 23(4):429-438. Epub 2017 Feb 20

PubMed ID: 28218918 DOI: 10.1038/nm.4287

Skorecki KL, Lee JH, Langefeld CD, Rosset S, Tzur S, Wasser WG, Shemer R, Hawkins GA, Divers J, Parekh RS, Li M, Sampson MG, Kretzler M, Pollak MR, Shah S, Blackler D, Nichols B, Wilmot M, Alper SL, Freedman BI, Friedman DJ

A null variant in the apolipoprotein L3 gene is associated with non-diabetic nephropathy

Nephrol Dial Transplant , 2017 Feb 20; 33(2):323-330. Epub 2017 Feb 20

PubMed ID: 28339911 DOI: 10.1093/ndt/gfw451

Kruzel-Davila E, Shemer R, Ofir A, Bavli-Kertselli I, Darlyuk-Saadon I, Oren-Giladi P, Wasser WG, Magen D, Zaknoun E, Schuldiner M, Salzberg A, Kornitzer D, Marelja Z, Simons M, Skorecki K

APOL1–Mediated Cell Injury Involves Disruption of Conserved Trafficking Processes

J Am Soc Nephrol , 2016 Nov 18; 28(4):1117-1130. Epub 2016 Nov 18

PubMed ID: 27864431 DOI: 10.1681/ASN.2016050546

Cheng D, Weckerle A, Yu Y, Ma L, Zhu X, Murea M, Freedman BI, Parks JS, Shelness GS

Biogenesis and cytotoxicity of APOL1 renal risk variant proteins in hepatocytes and hepatoma cells

J Lipid Res , 2015 Aug; 56(8):1583-1593

PubMed ID: 26089538 DOI: 10.1194/jlr.M059733

Heneghan JF, Vandorpe DH, Shmukler BE, Giovinazzo JA, Raper J, Friedman DJ, Pollak MR, Alper SL

BH3 domain-independent apolipoprotein L1 toxicity rescued by BCL2 prosurvival proteins

Am J Physiol Cell Physiol , 2015 Jun 24; 309(5):C332-C347. Epub 2015 Jun 24

PubMed ID: 26108665 DOI: 10.1152/ajpcell.00142.2015

Khatua AK, Cheatham AM, Kruzel ED, Singhal PC, Skorecki K, Popik W

Exon 4-encoded sequence is a major determinant of cytotoxicity of apolipoprotein L1

Am J Physiol Cell Physiol , 2015 Apr 29; 309(1):C22-C37. Epub 2015 Apr 29

PubMed ID: 25924622 DOI: 10.1152/ajpcell.00384.2014

Ma L, Shelness GS, Snipes JA, Murea M, Antinozzi PA, Cheng D, Saleem MA, Satchell SC, Banas B, Mathieson PW, Kretzler M, Hemal AK, Rudel LL, Petrovic S, Weckerle A, Pollak MR, Ross MD, Parks JS, Freedman BI

Localization of APOL1 Protein and mRNA in the Human Kidney: Nondiseased Tissue, Primary Cells, and Immortalized Cell Lines

J Am Soc Nephrol , 2014 Jul 10; 26(2):339-348. Epub 2014 Jul 10

PubMed ID: 25012173 DOI: 10.1681/ASN.2013091017

Johnstone DB, Shegokar V, Nihalani D, Rathore YS, Mallik L, Ashish, Zare V, Ikizler HO, Powar R, Holzman LB

APOL1 Null Alleles from a Rural Village in India Do Not Correlate with Glomerulosclerosis

PLoS One , 2012; 7(12):e51546. Epub 2012 Dec 26

PubMed ID: 23300552 DOI: 10.1371/journal.pone.0051546

Madhavan SM, O'Toole JF, Konieczkowski M, Ganesan S, Bruggeman LA, Sedor JR

APOL1 Localization in Normal Kidney and Nondiabetic Kidney Disease

J Am Soc Nephrol , 2011 Nov; 22(11):2119-2128

PubMed ID: 21997392 DOI: 10.1681/ASN.2011010069

Did we miss your publication?

Have you published using HPA018885? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch