1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-APOA4
Enhanced Validation

Anti-APOA4 Antibody

apolipoprotein A-IV
References (4)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human APOA4
Open Datasheet
Price
$437.00
Product Number
HPA001352
Unit Size
100 µl
Concentration
Lot dependent
Availability
10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human small intestine and liver tissues using HPA001352 antibody. Corresponding APOA4 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in control (vector only transfected HEK293T lysate) and APOA4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424692).

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target protein
apolipoprotein A-IV
Target gene
APOA4
Antigen sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000032080 (65%)

Rat ENSRNOG00000055909 (63%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
[This part should be hidden or updated after call to Current Batch]
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA001352 on the Human Protein Atlas
Western Blot (WB)

Recombinant expression validation in WB using target protein overexpression.

Protein Name
apolipoprotein A-IV
Gene Name
APOA4
UniProt ID
P06727
Gene (Ensembl)
ENSG00000110244
Entrez Gene ID
Entrez gene: 337
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000110244 on the Human Protein Atlas

Mistry HD, Kurlak LO, Mansour YT, Zurkinden L, Mohaupt MG, Escher G

Increased maternal and fetal cholesterol efflux capacity and placental CYP27A1 expression in preeclampsia

J Lipid Res , 2017 Apr 10; 58(6):1186-1195. Epub 2017 Apr 10

PubMed ID: 28396342 DOI: 10.1194/jlr.M071985

Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM

Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model

Proteome Sci , 2011 Nov 17; 9:73. Epub 2011 Nov 17

PubMed ID: 22093360 DOI: 10.1186/1477-5956-9-73

Levin Y, Wang L, Schwarz E, Koethe D, Leweke FM, Bahn S

Global proteomic profiling reveals altered proteomic signature in schizophrenia serum.

Mol Psychiatry , 2010 Nov; 15(11):1088-100. Epub 2009 Jun 23

PubMed ID: 19546861 DOI: 10.1038/mp.2009.54

Did we miss your publication?

Have you published using HPA001352? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not articipate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 50% of the product price as a refund, or 50% discount on your next vial purchase.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch
  1. Home
  2. Products
  3. Primary Antibodies
  4. Triple A Polyclonals
  5. Anti-APOA4