Enhanced Validation

Polyclonal Anti-ANXA1 Antibody

annexin A1
References (3)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ANXA1
Alternative Gene Names
ANX1, LPC1
Open Datasheet
Price
$459.00
Product Number
HPA011272
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[7 pictures]
Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using HPA011272 antibody. Corresponding ANXA1 RNA-seq data are presented for the same tissues.
Show all images
[3 pictures]
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANXA1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
annexin A1
Target Gene
ANXA1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000017469 (92%)

Mouse ENSMUSG00000024659 (89%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Validated against independent antibody Anti-ANXA1 HPA011271.

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA011272 on the Human Protein Atlas
Western Blot (WB)

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Genetic validation in WB by siRNA knockdown.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA011272 on the Human Protein Atlas
Protein Name
annexin A1
Gene Name
ANXA1
Alternative Gene Names
ANX1, LPC1
UniProt ID
P04083
Gene (Ensembl)
ENSG00000135046
Entrez Gene ID
Entrez gene: 301
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000135046 on the Human Protein Atlas

Elhassan YS, Kluckova K, Fletcher RS, Schmidt MS, Garten A, Doig CL, Cartwright DM, Oakey L, Burley CV, Jenkinson N, Wilson M, Lucas SJ, Akerman I, Seabright A, Lai YC, Tennant DA, Nightingale P, Wallis GA, Manolopoulos KN, Brenner C, Philp A, Lavery GG

Nicotinamide Riboside Augments the Aged Human Skeletal Muscle NAD+ Metabolome and Induces Transcriptomic and Anti-inflammatory Signatures

Cell Rep , 2019 Aug 13; 28(7):1717-1728.e6. Epub 2019 Aug 13

PubMed ID: 31412242 DOI: 10.1016/j.celrep.2019.07.043

Niinivirta M, Enblad G, Edqvist PH, Pontén F, Dragomir A, Ullenhag GJ

Tumoral ANXA1 Is a Predictive Marker for Sunitinib Treatment of Renal Cancer Patients

J Cancer , 2017 Oct 23; 8(19):3975-3983. Epub 2017 Oct 23

PubMed ID: 29187872 DOI: 10.7150/jca.20889

Did we miss your publication?

Have you published using HPA011272? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-ANXA1 (AMAb90558)
Anti-ANXA1 (HPA011271)
Corresponding Antigens
PrEST Antigen ANXA1 (APrEST71576)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch