Enhanced Validation

Polyclonal Anti-ANLN Antibody

anillin, actin binding protein
References (5)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ANLN
Alternative Gene Names
ANILLIN, scra, Scraps
Open Datasheet
Price
$505.00
Product Number
HPA005680
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA005680 antibody. Corresponding ANLN RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANLN antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
anillin, actin binding protein
Target Gene
ANLN
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000036777 (76%)

Rat ENSRNOG00000014343 (76%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:50 - 1:200

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA005680 on the Human Protein Atlas
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
anillin, actin binding protein
Gene Name
ANLN
Alternative Gene Names
ANILLIN, scra, Scraps
UniProt ID
Q9NQW6
Gene (Ensembl)
ENSG00000011426
Entrez Gene ID
Entrez gene: 54443
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000011426 on the Human Protein Atlas

Chen AS, Wardwell-Ozgo J, Shah NN, Wright D, Appin CL, Vigneswaran K, Brat DJ, Kornblum HI, Read RD

Drak/STK17A drives neoplastic glial proliferation through modulation of MRLC signaling

Cancer Res , 2018 Dec 10; 79(6):1085-1097. Epub 2018 Dec 10

PubMed ID: 30530503 DOI: 10.1158/0008-5472.CAN-18-0482

Magnusson K, Gremel G, Rydén L, Pontén V, Uhlén M, Dimberg A, Jirström K, Pontén F

ANLN is a prognostic biomarker independent of Ki-67 and essential for cell cycle progression in primary breast cancer

BMC Cancer , 2016 Nov 18; 16:904. Epub 2016 Nov 18

PubMed ID: 27863473 DOI: 10.1186/s12885-016-2923-8

O Leary PC, Penny SA, Dolan RT, Kelly CM, Madden SF, Rexhepaj E, Brennan DJ, McCann AH, Pontén F, Uhlén M, Zagozdzon R, Duffy MJ, Kell MR, Jirström K, Gallagher WM

Systematic antibody generation and validation via tissue microarray technology leading to identification of a novel protein prognostic panel in breast cancer.

BMC Cancer , 2013 Apr 2; 13:175. Epub 2013 Apr 2

PubMed ID: 23547718 DOI: 10.1186/1471-2407-13-175

Hjelm B, Forsström B, Igel U, Johannesson H, Stadler C, Lundberg E, Ponten F, Sjöberg A, Rockberg J, Schwenk JM, Nilsson P, Johansson C, Uhlén M

Generation of monospecific antibodies based on affinity capture of polyclonal antibodies.

Protein Sci , 2011 Nov; 20(11):1824-35. Epub 2011 Oct 12

PubMed ID: 21898641 DOI: 10.1002/pro.716

Did we miss your publication?

Have you published using HPA005680? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Alternative Antibodies
Anti-ANLN (AMAb90660)
Anti-ANLN (AMAb90662)
Anti-ANLN (HPA050556)
Corresponding Antigens
PrEST Antigen ANLN (APrEST70193)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch