Enhanced Validation

Polyclonal Anti-ALDH1A2 Antibody

aldehyde dehydrogenase 1 family, member A2
References (18)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ALDH1A2
Alternative Gene Names
RALDH2
Open Datasheet
Price
$505.00
Product Number
HPA010022
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[5 pictures]
Immunohistochemistry analysis in human endometrium and skin tissues using HPA010022 antibody. Corresponding ALDH1A2 RNA-seq data are presented for the same tissues.
Show all images
[1 pictures]
Western blot analysis in human cell line K562.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
aldehyde dehydrogenase 1 family, member A2
Target Gene
ALDH1A2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000013584 (98%)

Rat ENSRNOG00000055049 (98%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:200 - 1:500

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

All IHC characterization data in 44 normal tissues and 20 cancers for HPA010022 on the Human Protein Atlas
Western Blot (WB)

Validated in Western blot using relevant lysates (see Western blot application images above)

Protein Name
aldehyde dehydrogenase 1 family, member A2
Gene Name
ALDH1A2
Alternative Gene Names
RALDH2
UniProt ID
O94788
Gene (Ensembl)
ENSG00000128918
Entrez Gene ID
Entrez gene: 8854
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000128918 on the Human Protein Atlas

Feng W, Bais A, He H, Rios C, Jiang S, Xu J, Chang C, Kostka D, Li G

Single-cell transcriptomic analysis identifies murine heart molecular features at embryonic and neonatal stages

Nat Commun , 2022 Dec 27; 13:7960. Epub 2022 Dec 27

PubMed ID: 36575170 DOI: 10.1038/s41467-022-35691-7

Zhou R, Chen Z, Xiao ZR, Wang SL, Rong C

HPV-Related Promoter Methylation-Based Gene Signature Predicts Clinical Prognosis of Patients With Cervical Cancer

Front Oncol , 2021 Oct 21; 11:753102. Epub 2021 Oct 21

PubMed ID: 34745985 DOI: 10.3389/fonc.2021.753102

Heinrich A, Bhandary B, Potter SJ, Ratner N, DeFalco T

Cdc42 activity in Sertoli cells is essential for maintenance of spermatogenesis

Cell Rep , 2021 Oct 26; 37(4):109885

PubMed ID: 34706238 DOI: 10.1016/j.celrep.2021.109885

DeSisto J, O’Rourke R, Jones HE, Pawlikowski B, Malek AD, Bonney S, Guimiot F, Jones KL, Siegenthaler JA

Single-Cell Transcriptomic Analyses of the Developing Meninges Reveal Meningeal Fibroblast Diversity and Function

Dev Cell , 2020 Jul 6; 54(1):43-59.e4

PubMed ID: 32634398 DOI: 10.1016/j.devcel.2020.06.009

Chen L, Dalton S

Multipotent Vascular Progenitor Cells of the Mesothelium Lineage Generated from Human Pluripotent Stem Cells

STAR Protoc , 2020 Jun 3; 1(1):100031. Epub 2020 Jun 3

PubMed ID: 33111082 DOI: 10.1016/j.xpro.2020.100031

Chassot AA, Le Rolle M, Jolivet G, Stevant I, Guigonis JM, Da Silva F, Nef S, Pailhoux E, Schedl A, Ghyselinck NB, Chaboissier MC

Retinoic acid synthesis by ALDH1A proteins is dispensable for meiosis initiation in the mouse fetal ovary

Sci Adv , 2020 May 22; 6(21):eaaz1261. Epub 2020 May 22

PubMed ID: 32494737 DOI: 10.1126/sciadv.aaz1261

DiNuoscio G, Atit RP

Wnt/β-catenin signaling in the mouse embryonic cranial mesenchyme is required to sustain the emerging differentiated meningeal layers

Genesis , 2019 Jan 22; 57(1):e23279. Epub 2019 Jan 22

PubMed ID: 30615824 DOI: 10.1002/dvg.23279

Shepherd C, Zhu D, Skelton AJ, Combe J, Threadgold H, Zhu L, Vincent TL, Stuart P, Reynard LN, Loughlin J

Functional Characterization of the Osteoarthritis Genetic Risk Residing at ALDH1A2 Identifies rs12915901 as a Key Target Variant

Arthritis Rheumatol , 2018 Aug 23; 70(10):1577-1587. Epub 2018 Aug 23

PubMed ID: 29732726 DOI: 10.1002/art.40545

Schäfer FM, Algarrahi K, Savarino A, Yang X, Seager C, Franck D, Costa K, Liu S, Logvinenko T, Adam R, Mauney JR

Mode of Surgical Injury Influences the Source of Urothelial Progenitors during Bladder Defect Repair

Stem Cell Reports , 2017 Nov 22; 9(6):2005-2017. Epub 2017 Nov 22

PubMed ID: 29173895 DOI: 10.1016/j.stemcr.2017.10.025

Xiaoping Bao, Xiaojun Lian, Tongcheng Qian, Vijesh J Bhute, Tianxiao Han, Sean P Palecek

Directed differentiation and long-term maintenance of epicardial cells derived from human pluripotent stem cells under fully defined conditions

Nature Protocols , 12, 1890-1900 (2017)

PubMed ID: None DOI: 10.1038/nprot.2017.080

Minkina A, Lindeman RE, Gearhart MD, Chassot AA, Chaboissier MC, Ghyselinck NB, Bardwell VJ, Zarkower D

Retinoic acid signaling is dispensable for somatic development and function in the mammalian ovary

Dev Biol , 2017 Mar 6; 424(2):208-220. Epub 2017 Mar 6

PubMed ID: 28274610 DOI: 10.1016/j.ydbio.2017.02.015

Penny HL, Prestwood TR, Bhattacharya N, Sun F, Kenkel JA, Davidson MG, Shen L, Zuniga LA, Seeley ES, Pai R, Choi O, Tolentino L, Wang J, Napoli JL, Engleman EG

Restoring Retinoic Acid Attenuates Intestinal Inflammation and Tumorigenesis in APCMin/+ Mice

Cancer Immunol Res , 2016 Sep 16; 4(11):917-926. Epub 2016 Sep 16

PubMed ID: 27638841 DOI: 10.1158/2326-6066.CIR-15-0038

Sato Y, Mii A, Hamazaki Y, Fujita H, Nakata H, Masuda K, Nishiyama S, Shibuya S, Haga H, Ogawa O, Shimizu A, Narumiya S, Kaisho T, Arita M, Yanagisawa M, Miyasaka M, Sharma K, Minato N, Kawamoto H, Yanagita M

Heterogeneous fibroblasts underlie age-dependent tertiary lymphoid tissues in the kidney

JCI Insight , 2016 Jul 21; 1(11):e87680. Epub 2016 Jul 21

PubMed ID: 27699223 DOI: 10.1172/jci.insight.87680

Seidensaal K, Nollert A, Feige AH, Muller M, Fleming T, Gunkel N, Zaoui K, Grabe N, Weichert W, Weber KJ, Plinkert P, Simon C, Hess J

Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma

Mol Cancer , 2015/12/03; 14:204. Epub 2015 Dec 3

PubMed ID: 26634247 DOI: 10.1186/s12943-015-0476-0

Harper AR, Wiechmann AF, Moiseyev G, Ma JX, Summers JA

Identification of Active Retinaldehyde Dehydrogenase Isoforms in the Postnatal Human Eye

PLoS One , 2015; 10(3):e0122008. Epub 2015 Mar 20

PubMed ID: 25793304 DOI: 10.1371/journal.pone.0122008

Rizzardi AE, Rosener NK, Koopmeiners JS, Isaksson Vogel R, Metzger GJ, Forster CL, Marston LO, Tiffany JR, McCarthy JB, Turley EA, Warlick CA, Henriksen JC, Schmechel SC

Evaluation of protein biomarkers of prostate cancer aggressiveness

BMC Cancer , 2014 Apr 5; 14:244. Epub 2014 Apr 5

PubMed ID: 24708576 DOI: 10.1186/1471-2407-14-244

Kostareli E, Holzinger D, Bogatyrova O, Hielscher T, Wichmann G, Keck M, Lahrmann B, Grabe N, Flechtenmacher C, Schmidt CR, Seiwert T, Dyckhoff G, Dietz A, Höfler D, Pawlita M, Benner A, Bosch FX, Plinkert P, Plass C, Weichenhan D, Hess J

HPV-related methylation signature predicts survival in oropharyngeal squamous cell carcinomas

J Clin Invest , 2013 Jun; 123(6):2488-2501. Epub 2013 May 1

PubMed ID: 23635773 DOI: 10.1172/JCI67010

Did we miss your publication?

Have you published using HPA010022? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen ALDH1A2 (APrEST71490)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch