Enhanced Validation

Polyclonal Anti-ALDH1A1 Antibody

aldehyde dehydrogenase 1 family, member A1
References (8)
Recommended Applications
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human ALDH1A1
Alternative Gene Names
ALDH1, PUMB1, RALDH1
Open Datasheet
Price
$459.00
Product Number
HPA002123
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[4 pictures]
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Show all images
[1 pictures]
Western blot analysis in human cell lines A-549 and A-431 using Anti-ALDH1A1 antibody. Corresponding ALDH1A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Show all images
[1 pictures]
Immunofluorescent staining of human cell line A549 shows localization to cytosol.

Additional Images

See additional IHC images using this antibody for 44 normal tissues and 20 cancers on the Human Protein Atlas
Target Protein
aldehyde dehydrogenase 1 family, member A1
Target Gene
ALDH1A1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
IYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000053279 (91%)

Rat ENSRNOG00000017619 (90%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:2500 - 1:5000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunohistochemistry (IHC)
All IHC characterization data in 44 normal tissues and 20 cancers for HPA002123 on the Human Protein Atlas
Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA002123 on the Human Protein Atlas
Protein Name
aldehyde dehydrogenase 1 family, member A1
Gene Name
ALDH1A1
Alternative Gene Names
ALDH1, PUMB1, RALDH1
UniProt ID
P00352
Gene (Ensembl)
ENSG00000165092
Entrez Gene ID
Entrez gene: 216
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000165092 on the Human Protein Atlas

Marie A, Leroy J, Darricau M, Alfos S, De Smedt-Peyrusse V, Richard E, Vancassel S, Bosch-Bouju C

Preventive Vitamin A Supplementation Improves Striatal Function in 6-Hydroxydopamine Hemiparkinsonian Rats

Front Nutr , 2022 Feb 1; 9:811843. Epub 2022 Feb 1

PubMed ID: 35178422 DOI: 10.3389/fnut.2022.811843

Canesin G, Maggio V, Palominos M, Stiehm A, Contreras HR, Castellón EA, Morote J, Paciucci R, Maitland NJ, Bjartell A, Hellsten R

STAT3 inhibition with galiellalactone effectively targets the prostate cancer stem-like cell population

Sci Rep , 2020 Aug 18; 10:13958. Epub 2020 Aug 18

PubMed ID: 32811873 DOI: 10.1038/s41598-020-70948-5

Taylor B, Rice A, Nicholson AG, Hind M, Dean CH

Mechanism of lung development in the aetiology of adult congenital pulmonary airway malformations

Thorax , 2020 Jul 30; 75(11):1001-1003. Epub 2020 Jul 30

PubMed ID: 32732323 DOI: 10.1136/thoraxjnl-2020-214752

Dorris ER, Blackshields G, Sommerville G, Alhashemi M, Dias A, McEneaney V, Smyth P, O'Leary JJ, Sheils O

Pluripotency markers are differentially induced by MEK inhibition in thyroid and melanoma BRAFV600E cell lines

Cancer Biol Ther , 2016 Feb 1; 17(5):526-542. Epub 2016 Feb 1

PubMed ID: 26828826 DOI: 10.1080/15384047.2016.1139230

Li X, Wu JB, Li Q, Shigemura K, Chung LW, Huang WC

SREBP-2 promotes stem cell-like properties and metastasis by transcriptional activation of c-Myc in prostate cancer

Oncotarget , 2016 Feb 11; 7(11):12869-12884. Epub 2016 Feb 11

PubMed ID: 26883200 DOI: 10.18632/oncotarget.7331

Harper AR, Wiechmann AF, Moiseyev G, Ma JX, Summers JA

Identification of Active Retinaldehyde Dehydrogenase Isoforms in the Postnatal Human Eye

PLoS One , 2015; 10(3):e0122008. Epub 2015 Mar 20

PubMed ID: 25793304 DOI: 10.1371/journal.pone.0122008

Szabo AZ, Fong S, Yue L, Zhang K, Strachan LR, Scalapino K, Mancianti ML, Ghadially R

The CD44+ALDH+ Population of Human Keratinocytes Is Enriched for Epidermal Stem Cells with Long-Term Repopulating Ability

Stem Cells , 2013 Apr; 31(4):786-799

PubMed ID: 23335266 DOI: 10.1002/stem.1329

Did we miss your publication?

Have you published using HPA002123? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Corresponding Antigens
PrEST Antigen ALDH1A1 (APrEST86228)

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch