Polyclonal Anti-AFDN Antibody

afadin, adherens junction formation factor
References (2)
Recommended Applications
Product Description
Polyclonal Antibody against Human AFDN
Alternative Gene Names
AF-6, AF6, MLLT4
Open Datasheet
Price
$505.00
Product Number
HPA049868
Unit Size
Concentration
Lot dependent
Availability
>10 in Stock
Ships
Ready to Ship
Show all images
[1 pictures]
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cell junctions.

Additional Images

See additional ICC images using this antibody on the Human Protein Atlas
Target Protein
afadin, adherens junction formation factor
Target Gene
AFDN
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDS
Verified Species Reactivity
Human
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000068036 (92%)

Rat ENSRNOG00000023753 (37%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Download data sheet
Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
View all protocols
Immunofluorescence in Cell Lines (ICC-IF)

All ICC-IF characterization data for HPA049868 on the Human Protein Atlas
Protein Name
afadin, adherens junction formation factor
Gene Name
AFDN
Alternative Gene Names
AF-6, AF6, MLLT4
UniProt ID
P55196
Gene (Ensembl)
ENSG00000130396
Entrez Gene ID
Entrez gene: 4301
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000130396 on the Human Protein Atlas

Tsurumi H, Kurihara H, Miura K, Tanego A, Ohta Y, Igarashi T, Oka A, Horita S, Hattori M, Harita Y

Afadin is localized at cell–cell contact sites in mesangial cells and regulates migratory polarity

Lab Invest , 2015 Dec 28; 96(1):49-59. Epub 2015 Dec 28

PubMed ID: 26568295 DOI: 10.1038/labinvest.2015.133

Did we miss your publication?

Have you published using HPA049868? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch