Enhanced Validation

Polyclonal Anti-ADPRHL2 Antibody

ADP-ribosylhydrolase like 2
Recommended Applications
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ADPRHL2
Alternative Gene Names
ARH3, FLJ20446
Price
$459.00
Product Number
HPA027104
Unit Size
Concentration
Lot dependent
Availability
On Demand
Ships
On Demand
Target Protein
ADP-ribosylhydrolase like 2
Target Gene
ADPRHL2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000010849 (91%)

Mouse ENSMUSG00000042558 (91%)

Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Unit Size
100 µl
Current Lot
Produced on demand. Contact support@atlasantibodies.com for more information.
Concentration
Product Data Sheet
Immunohistochemistry (IHC)

Recommended conditions:

Dilution: 1:500 - 1:1000

Retrieval method: HIER pH6

Western Blot (WB)

Recommended conditions:

Working concentration: 0.04-0.4 µg/ml

Immunofluorescence in Cell Lines (ICC-IF)

Recommended conditions:

Fixation/Permeabilization: PFA/Triton X-100

Working concentration: 0.25-2 µg/ml

Protocols
Western Blot (WB)

Genetic validation in WB by siRNA knockdown.

Protein Name
ADP-ribosylhydrolase like 2
Gene Name
ADPRHL2
Alternative Gene Names
ARH3, FLJ20446
UniProt ID
Gene (Ensembl)
Entrez Gene ID
Shipping
Normally shipped at ambient temperature
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Human Protein Atlas

This antibody has been used for staining of 44 normal human tissue samples as well as human cancer samples covering the 20 most common cancer types and up to 12 patients for each cancer type. The results are part of an ongoing effort to map the human proteome using antibodies.

All characterization data for ENSG00000116863 on the Human Protein Atlas

Hanzlikova H, Prokhorova E, Krejcikova K, Cihlarova Z, Kalasova I, Kubovciak J, Sachova J, Hailstone R, Brazina J, Ghosh S, Cirak S, Gleeson JG, Ahel I, Caldecott KW

Pathogenic ARH3 mutations result in ADP-ribose chromatin scars during DNA strand break repair

Nat Commun , 2020 Jul 7; 11:3391. Epub 2020 Jul 7

PubMed ID: 32636369 DOI: 10.1038/s41467-020-17069-9

Bartlett E, Bonfiglio JJ, Prokhorova E, Colby T, Zobel F, Ahel I, Matic I

Interplay of Histone Marks with Serine ADP-Ribosylation

Cell Rep , 2018 Sep 25; 24(13):3488-3502.e5. Epub 2018 Sep 25

PubMed ID: 30257210 DOI: 10.1016/j.celrep.2018.08.092

Palazzo L, Leidecker O, Prokhorova E, Dauben H, Matic I, Ahel I

Serine is the major residue for ADP-ribosylation upon DNA damage

eLife , 2018 Feb 26; 7:e34334. Epub 2018 Feb 26

PubMed ID: 29480802 DOI: 10.7554/eLife.34334

Fontana P, Bonfiglio JJ, Palazzo L, Bartlett E, Matic I, Ahel I

Serine ADP-ribosylation reversal by the hydrolase ARH3

eLife , 2017 Jun 26; 6:e28533. Epub 2017 Jun 26

PubMed ID: 28650317 DOI: 10.7554/eLife.28533

Did we miss your publication?

Have you published using HPA027104? Please let us know and we will be happy to include your reference on this page.

Read more

Join the Explorer Program

Are you using our products in an application or species we have not yet tested? Why not participate in the Explorer Program, and we will show your contribution here. If you would like to share your results with us, the Explorer Program offers a 25µl vial free of charge with your next order.

Read more

Questions?

Our customer support and expert scientific support teams are here to help you succeed in your research.

Get in touch